Recombinant Arabidopsis thaliana Magnesium transporter MRS2-6, mitochondrial (MRS2-6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
MRS2-6; MGT5; At4g28580; T5F17.30; Magnesium transporter MRS2-6, mitochondrial; Magnesium Transporter 5; AtMGT5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
97-408
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-6
Target Protein Sequence
AREKAIVLNLEVIKAVITSEQVMLLDSLRPEVLTLTDRLKHHFPRKDGPENILQASSHGH QEGGEEGLKSKLPFEFRVLEIAFEVFCSFVDSNVVDLETQAWSILDELTKKVSNENLKDL RSLKTSLTHLLARVQKVRDEIEHFLDDKEDMEDLYLTRKWIQNQQTEAASNSIVSQPNLQ RHTSNRISTSMVTEEDDIDDMEMLLEAYFMQLEGMRNKILLMKEHIDSTEAYVKILQNSR RNGLIHLMMLVNIGNYAITAGTVVVNLFGMNIPIGLYSTPDIFGYVVWAVVALCIVLFIV TVGYAKWKKLLD
Uniprot No.

Target Background

Function
This recombinant Arabidopsis thaliana protein, Magnesium transporter MRS2-6, mitochondrial (MRS2-6), is a magnesium transporter that mediates magnesium influx and efflux in a concentration-dependent manner. It plays a critical role in male gametophyte development and male fertility.
Gene References Into Functions
  1. MGT5 plays a crucial role in Mg transport from the tapetum to the microspore in Arabidopsis. PMID: 26478267
  2. AtMGT5 is essential for pollen development and male fertility. PMID: 19825572
Database Links

KEGG: ath:AT4G28580

STRING: 3702.AT4G28580.1

UniGene: At.32007

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in flowers notably in anthers at early stages of flower development.

Q&A

What is MRS2-6 and how is it classified within the magnesium transporter family?

MRS2-6 (alternatively designated as MGT5 or AtMGT5) is a member of the MRS2/MGT gene family in Arabidopsis thaliana. It belongs to the superfamily of CorA-MRS2-ALR-type membrane proteins, which are characterized by a conserved GMN (Gly-Met-Asn) tripeptide motif located at the end of the first of two C-terminal transmembrane domains. The Arabidopsis MRS2/MGT family consists of 10 members that have been shown to function as magnesium transporters . MRS2-6 is specifically encoded by the gene At4g28580 (also labeled as T5F17.30) and is localized to the mitochondria, playing a role in magnesium transport across mitochondrial membranes .

What is the functional importance of the GMN motif in MRS2-6?

The GMN tripeptide motif is a defining characteristic of the CorA-MRS2-ALR-type membrane proteins. This highly conserved motif is crucial for magnesium transport function. The glycine residue provides conformational flexibility, the methionine contributes to the hydrophobic environment necessary for ion selectivity, and the asparagine participates in coordination of the magnesium ion. Mutation studies across multiple members of this protein family have demonstrated that alterations to this motif typically result in loss of magnesium transport activity. For MRS2-6 specifically, the GMN motif is essential for its ability to complement yeast mrs2 mutants, as demonstrated in functional complementation assays .

How does MRS2-6 expression compare to other members of the MRS2/MGT family?

The members of the MRS2/MGT family in Arabidopsis display highly different patterns of tissue-specific expression. While six members of the family are expressed in root tissues (suggesting involvement in magnesium uptake from soil and subsequent distribution), MRS2-6 shows a distinct expression pattern. Based on the available data, MRS2-6, along with MRS2-2 and MRS2-3, appears to be particularly active during the reproductive stage of plant development . Notably, when examining publicly available microarray data, there is no clear evidence for environmental regulation of MRS2 genes, including MRS2-6, and their expression patterns do not appear to change significantly in response to varying magnesium concentrations in the growth medium .

What is known about the structure of MRS2-6 protein?

The mature MRS2-6 protein spans amino acids 97-408 of the full-length sequence. Like other members of the CorA-MRS2-ALR superfamily, MRS2-6 is characterized by two transmembrane domains at the C-terminus with the conserved GMN motif at the end of the first transmembrane domain. While the exact three-dimensional structure of plant MRS2-6 has not been fully resolved, insights can be gained from studies of human MRS2, which forms a homo-pentameric structure with specific residues identified as major gating residues (R332 and M336 in human MRS2) . The pentameric assembly creates a central pore through which magnesium ions are transported. Based on homology, Arabidopsis MRS2-6 likely adopts a similar quaternary structure, though plant-specific structural features may exist.

What expression systems are optimal for producing functional recombinant MRS2-6?

The most widely reported system for expressing recombinant MRS2-6 is Escherichia coli. Specifically, the mature protein (amino acids 97-408) fused to an N-terminal His-tag has been successfully expressed in E. coli systems . When preparing recombinant MRS2-6, researchers should consider the following methodological approaches:

  • Vector selection: pET-based vectors with strong inducible promoters

  • E. coli strain: BL21(DE3) or its derivatives are commonly used for membrane protein expression

  • Induction conditions: Lower temperatures (16-20°C) after induction and reduced IPTG concentrations (0.1-0.5 mM) often improve the yield of properly folded membrane proteins

  • Solubilization: Appropriate detergents (n-dodecyl-β-D-maltoside or CHAPS) for membrane protein extraction

Alternative expression systems, such as yeast (S. cerevisiae or P. pastoris) or insect cells using baculovirus systems, may provide better folding environments for functional studies requiring native-like protein conformation .

How can MRS2-6 magnesium transport activity be measured in experimental settings?

Several complementary approaches can be used to assess the magnesium transport activity of MRS2-6:

  • Yeast complementation assay: The mrs2Δ yeast mutant, which exhibits growth defects on non-fermentable carbon sources due to impaired mitochondrial magnesium uptake, can be transformed with MRS2-6 constructs. Restoration of growth on media containing glycerol (YPdG) indicates functional complementation .

  • Mag-fura-2 fluorescence assay: This UV-excitable, Mg2+-dependent fluorescent indicator undergoes a blue shift from 380 to 340 nm upon Mg2+ binding. Isolated mitochondria loaded with mag-fura-2 can be used to directly measure Mg2+ uptake after external application of increasing Mg2+ concentrations .

  • Patch-clamp electrophysiology: For more detailed kinetic analysis, MRS2-6 can be reconstituted into proteoliposomes or expressed in suitable cell systems for patch-clamp studies to measure ion currents.

  • Isotope uptake assays: Using 28Mg2+ to track magnesium transport in cellular or reconstituted systems.

MethodAdvantagesLimitationsKey Parameters
Yeast complementationPhysiological context, simple setupQualitative, indirect measurementGrowth conditions, expression levels
Mag-fura-2 fluorescenceDirect measurement, real-time kineticsRequires isolated organellesDye loading, calibration curve
Patch-clampPrecise kinetic parametersTechnical complexityMembrane stability, seal resistance
Isotope uptakeDirect quantificationLimited availability of isotopesSpecific activity, background control

What are the most effective approaches for studying MRS2-6 localization and trafficking?

To study the subcellular localization and trafficking of MRS2-6, researchers can employ several techniques:

  • Fluorescent protein fusions: Creating C-terminal GFP or YFP fusions while preserving the N-terminal mitochondrial targeting sequence. Care must be taken to ensure the fusion does not disrupt protein folding or targeting.

  • Immunofluorescence microscopy: Using specific antibodies against MRS2-6 or epitope tags in fixed cells, combined with mitochondrial markers such as MitoTracker.

  • Subcellular fractionation: Isolating mitochondria and other cellular compartments followed by western blot analysis to detect the presence of MRS2-6.

  • Protease protection assays: Determining the membrane topology of MRS2-6 by treating isolated mitochondria with proteases in the presence or absence of membrane-disrupting detergents.

For researchers interested in MRS2-6 trafficking to mitochondria, pulse-chase experiments with inducible expression systems can reveal the kinetics of protein import. Additionally, site-directed mutagenesis of predicted targeting signals can help identify sequences critical for proper localization .

How can genetic knockouts or knockdowns of MRS2-6 be generated, and what phenotypes result?

Several approaches can be used to generate MRS2-6 knockout or knockdown lines:

  • T-DNA insertion lines: Multiple Arabidopsis T-DNA insertion collections (SALK, SAIL, GABI-Kat) contain insertional mutants in the MRS2-6 gene. These can be confirmed by PCR-based genotyping and RT-PCR to verify disruption of gene expression.

  • CRISPR/Cas9 genome editing: This approach can generate precise deletions or insertions in the MRS2-6 coding sequence.

  • RNA interference (RNAi): Expressing MRS2-6-specific hairpin constructs can achieve knockdown rather than complete knockout.

  • Artificial microRNAs (amiRNAs): Design of specific amiRNAs targeting MRS2-6 mRNA can provide controlled levels of knockdown.

What approaches can be used to study MRS2-6 interactions with other proteins?

Several complementary techniques can be employed to investigate MRS2-6 protein interactions:

  • Yeast two-hybrid (Y2H): While traditional Y2H may be challenging for full-length membrane proteins like MRS2-6, modified membrane Y2H systems or using specific domains can identify potential interacting partners.

  • Co-immunoprecipitation (Co-IP): Using antibodies against MRS2-6 or epitope-tagged versions to pull down protein complexes from solubilized mitochondrial membranes.

  • Bimolecular Fluorescence Complementation (BiFC): Fusing MRS2-6 and potential interacting partners to complementary fragments of a fluorescent protein to visualize interactions in living cells.

  • Proximity-dependent biotin labeling (BioID or TurboID): Fusing MRS2-6 to a biotin ligase to identify nearby proteins in the native cellular environment.

  • Cross-linking mass spectrometry: Chemical cross-linking of protein complexes followed by mass spectrometry analysis to identify interacting partners and interaction sites.

When investigating MRS2-6 interactions, researchers should consider its mitochondrial localization and membrane integration, which may necessitate specialized approaches for solubilization and maintaining protein stability during interaction studies .

How can the functional relationship between MRS2-6 and other MRS2/MGT family members be determined?

To elucidate the functional relationships between MRS2-6 and other family members, several strategic approaches can be employed:

  • Generation of multiple knockout lines: Creating double, triple, or higher-order mutants combining mrs2-6 with mutations in other family members can reveal functional redundancy or unique roles. This approach has been successfully used with other MRS2 family members (e.g., mrs2-1/5/10 triple knockouts) .

  • Expression pattern comparison: Detailed analysis of spatiotemporal expression patterns using promoter-reporter constructs (e.g., pMRS2-6:GUS) to identify overlapping or distinct expression domains compared to other family members .

  • Complementation experiments: Testing whether MRS2-6 can rescue phenotypes of other mrs2 mutants and vice versa when expressed under the same promoter.

  • Heterologous expression systems: Comparing magnesium transport capabilities in systems like yeast mrs2 mutants to quantify relative transport efficiencies among family members .

  • Chimeric protein analysis: Creating chimeric proteins by swapping domains between MRS2-6 and other family members to identify regions responsible for functional specificity.

These approaches should be conducted under varying magnesium concentrations, as functional relationships may be more evident under limiting or excess conditions .

What factors influence MRS2-6 regulation at transcriptional and post-translational levels?

While current literature indicates that MRS2 genes, including MRS2-6, do not show obvious magnesium-dependent transcriptional regulation , more nuanced regulatory mechanisms may exist:

  • Transcriptional regulation: Although direct magnesium-responsive elements have not been identified in the MRS2-6 promoter, examination of cis-regulatory elements may reveal binding sites for transcription factors involved in developmental or stress responses. Chromatin immunoprecipitation (ChIP) and promoter deletion analyses can identify key regulatory regions.

  • Post-transcriptional regulation: Alternative splicing may generate different MRS2-6 isoforms. RNA-seq data analysis across different conditions and tissues can reveal such variants. Additionally, miRNA-mediated regulation should be investigated using bioinformatic prediction tools followed by validation experiments.

  • Post-translational modifications: Phosphorylation is a likely regulatory mechanism for MRS2-6 activity. Mass spectrometry-based phosphoproteomic analysis of MRS2-6 isolated from plants grown under different conditions can identify regulatory phosphorylation sites. Other potential modifications include ubiquitination, which may regulate protein turnover.

  • Protein-protein interactions: The activity of MRS2-6 may be modulated through interactions with regulatory proteins. Approaches outlined in question 4.2 can identify such interactors.

  • Feedback regulation: Cellular magnesium levels might influence MRS2-6 activity through allosteric mechanisms rather than expression changes. Structural studies and mutagenesis of potential regulatory sites can reveal such mechanisms .

How does MRS2-6 contribute to magnesium homeostasis in relation to other transporters and channels?

MRS2-6 functions within a complex network of transporters that collectively maintain magnesium homeostasis. Understanding its specific contribution requires multiple experimental approaches:

  • Organelle-specific magnesium measurements: Using targeted magnesium sensors to quantify mitochondrial magnesium levels in wild-type versus mrs2-6 knockout plants can reveal its contribution to compartmental magnesium distribution.

  • Flux analysis: Measuring magnesium flux rates between cellular compartments in the presence and absence of functional MRS2-6 using radioisotope tracers or real-time imaging with magnesium-sensitive fluorescent probes.

  • Physiological impact assessment: Examining mitochondrial function parameters (membrane potential, ATP production, respiratory capacity) in mrs2-6 mutants compared to wild-type under varying magnesium conditions.

  • Interaction with calcium homeostasis: Given the evidence for interplay between magnesium and calcium homeostasis , researchers should investigate how MRS2-6 function affects calcium distribution and vice versa, possibly using dual-label imaging or sequential ion replacement experiments.

  • Systems biology approach: Combining transcriptomics, proteomics, and metabolomics data from mrs2-6 mutants to create network models of compensatory responses in magnesium homeostasis machinery.

Understanding these relationships is crucial as different transporters may compensate for each other's functions, potentially masking phenotypes in single gene knockout studies .

What structural features determine MRS2-6 ion selectivity and transport mechanism?

Based on structural studies of related transporters, particularly the human MRS2 homolog , several key structural features likely determine MRS2-6 ion selectivity and transport mechanism:

  • GMN motif: This highly conserved tripeptide provides the primary coordination site for magnesium ions. Site-directed mutagenesis of these residues, followed by functional assays, can confirm their importance in MRS2-6.

  • Transmembrane domains: The two C-terminal transmembrane domains form the ion conduction pathway. Cysteine scanning mutagenesis coupled with accessibility assays can map the pore structure.

  • Gating residues: By analogy with human MRS2, where R332 and M336 serve as major gating residues , the corresponding residues in MRS2-6 likely play similar roles. Charge-reversal or hydrophobicity-altering mutations at these positions can test their function.

  • Selectivity filter: The precise arrangement of amino acids that discriminates between Mg2+ and other divalent cations needs to be identified. Competition assays with different ions in transport systems expressing wild-type or mutant MRS2-6 can reveal key selectivity determinants.

  • Oligomerization interfaces: As MRS2-6 likely forms a homopentamer similar to human MRS2 , the residues involved in subunit interactions are important for channel assembly and potentially for cooperative gating. Cross-linking studies combined with mass spectrometry can identify these interfaces.

Researchers attempting to resolve these questions should consider combining computational approaches (homology modeling, molecular dynamics simulations) with experimental validation using site-directed mutagenesis and functional assays .

What are common challenges in expressing and purifying recombinant MRS2-6, and how can they be addressed?

Membrane proteins like MRS2-6 present several challenges during recombinant expression and purification:

  • Low expression levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and test multiple expression strains. Consider fusion tags that enhance solubility (MBP, SUMO) in addition to purification tags.

  • Protein misfolding and aggregation:

    • Challenge: Improper folding leading to inclusion body formation.

    • Solution: Lower induction temperature (16-18°C), reduce inducer concentration, and include molecular chaperones as co-expression partners. For severe cases, consider refolding protocols from solubilized inclusion bodies.

  • Detergent selection for solubilization:

    • Challenge: Finding detergents that efficiently extract MRS2-6 while preserving its native structure.

    • Solution: Screen a panel of detergents (DDM, LMNG, CHAPS, etc.) at different concentrations. Consider fluorescence-based thermal stability assays to identify conditions that maintain protein stability.

  • Purification optimization:

    • Challenge: Obtaining homogeneous preparations with high purity.

    • Solution: Use two-step purification strategies combining affinity chromatography (Ni-NTA for His-tagged MRS2-6) followed by size exclusion chromatography to remove aggregates and obtain homogeneous oligomeric states.

  • Protein stability during storage:

    • Challenge: Loss of activity during storage.

    • Solution: Include stabilizing agents such as glycerol (6-50%) and test different buffer compositions. For long-term storage, lyophilization in the presence of trehalose has been reported as effective for MRS2-6 .

StageCommon ProblemSolution StrategySuccess Indicator
ExpressionLow yieldOptimize induction conditions, use specialized strainsWestern blot detection
SolubilizationPoor extractionTest multiple detergents, optimize concentration and timeClear supernatant after centrifugation
PurificationContaminants or aggregatesMulti-step chromatography, optimize imidazole gradientSingle band on SDS-PAGE, monodisperse peak on SEC
StorageActivity lossAdd stabilizers, determine optimal pH and ionic strengthRetained functional activity after storage

How can researchers address contradictory findings regarding MRS2-6 function or localization?

Contradictory findings in the literature can arise from various factors. Researchers should systematically address these discrepancies through:

  • Standardization of experimental conditions:

    • Clearly define plant growth conditions, particularly magnesium concentrations, which can mask or reveal phenotypes.

    • Standardize protein expression and purification protocols, as variations can affect protein functionality.

    • Use consistent cell types and developmental stages for localization studies.

  • Validation with multiple independent techniques:

    • Confirm localization using both fluorescent protein fusions and immunolocalization with specific antibodies.

    • Validate transport activity using complementary approaches (yeast complementation, direct transport assays, electrophysiology).

    • Use multiple knockout alleles or knockdown approaches to verify phenotypes.

  • Consider genetic background effects:

    • Use identical ecotypes when comparing results between studies.

    • Generate multiple independent transgenic lines to control for position effects.

    • Include appropriate wild-type controls from the same seed batch in all experiments.

  • Address functional redundancy:

    • Create higher-order mutants when single mutant phenotypes are subtle or variable.

    • Quantify expression levels of other family members in mutant backgrounds to detect compensatory responses.

  • Systematic meta-analysis:

    • When faced with contradictory findings, conduct a systematic review of methodologies across studies.

    • Reproduce key experiments from conflicting studies side-by-side under identical conditions.

    • Consider publishing protocol papers that establish standardized methods for the field .

What quality control methods are essential when working with recombinant MRS2-6?

To ensure reproducible results when working with recombinant MRS2-6, researchers should implement rigorous quality control measures:

  • Purity assessment:

    • SDS-PAGE analysis with both Coomassie and silver staining.

    • Western blot with anti-His antibodies and, when available, MRS2-6-specific antibodies.

    • Mass spectrometry to confirm protein identity and detect post-translational modifications or degradation products.

  • Structural integrity verification:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content.

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm oligomeric state.

    • Thermal shift assays to evaluate protein stability under different buffer conditions.

  • Functional verification:

    • Magnesium transport assays using fluorescent indicators like mag-fura-2.

    • Yeast complementation assays to confirm biological activity.

    • Liposome reconstitution followed by ion flux measurements.

  • Batch-to-batch consistency:

    • Maintain detailed records of expression and purification conditions.

    • Prepare reference standards and compare new preparations against these standards.

    • Develop quantitative activity assays that allow normalization between batches.

  • Storage stability monitoring:

    • Periodically re-test protein samples during storage using activity assays.

    • Monitor for aggregation using dynamic light scattering or native PAGE.

    • Establish maximum storage durations based on stability data .

By implementing these quality control measures, researchers can ensure that observed effects are due to MRS2-6 activity rather than artifacts arising from impure or improperly folded protein preparations.

What are the most promising strategies for resolving the high-resolution structure of MRS2-6?

Given the challenges of membrane protein structural biology, several complementary approaches hold promise for resolving the high-resolution structure of MRS2-6:

  • Cryo-electron microscopy (cryo-EM):

    • This approach has recently succeeded for human MRS2 and would be applicable to the plant homolog.

    • Strategies should include optimization of detergent or nanodisc reconstitution, potentially using new amphipathic polymers like SMALPs (styrene-maleic acid lipid particles) that preserve the native lipid environment.

    • Sample homogeneity is critical; therefore, rigorous purification protocols and screening of multiple constructs with varying termini may be necessary.

  • X-ray crystallography:

    • While challenging for membrane proteins, crystallization might be achieved using lipidic cubic phase (LCP) techniques.

    • Systematic screening of truncation constructs, thermostabilizing mutations, and crystallization chaperones (antibody fragments, nanobodies) could facilitate crystal formation.

    • Fusion partners that promote crystallization, such as T4 lysozyme or BRIL, inserted into loop regions might enhance success rates.

  • NMR spectroscopy approaches:

    • Solution NMR of specific domains (e.g., soluble regions) combined with solid-state NMR of the transmembrane regions.

    • Selective isotope labeling of key residues to probe specific structural features.

  • Hybrid methods:

    • Integrating lower-resolution structural data from small-angle X-ray scattering (SAXS) or negative-stain EM with computational modeling.

    • Cross-linking mass spectrometry to identify spatial relationships between protein regions.

    • Hydrogen-deuterium exchange mass spectrometry to map solvent-accessible regions and conformational dynamics.

  • Computational approaches:

    • AlphaFold2 or RoseTTAFold predictions as starting models, refined using experimental constraints.

    • Molecular dynamics simulations to understand dynamic aspects of channel gating .

How might MRS2-6 be engineered to create tools for studying magnesium homeostasis?

Engineered variants of MRS2-6 could serve as valuable tools for studying magnesium homeostasis:

  • Genetically encoded magnesium sensors:

    • Fusion of MRS2-6 with fluorescent proteins capable of FRET, positioned to undergo conformational changes upon magnesium binding or transport.

    • Creation of split fluorescent protein systems where MRS2-6 conformation changes bring fragments together.

    • Development of MRS2-6-based luciferase complementation assays for non-invasive monitoring in whole plants.

  • Controllable MRS2-6 variants:

    • Engineering light-sensitive domains into MRS2-6 to create optogenetic tools for spatiotemporal control of magnesium transport.

    • Development of chemical-inducible systems where small molecules can trigger MRS2-6 activation or inhibition.

    • Creation of temperature-sensitive variants for conditional activation.

  • Modified selectivity or kinetics:

    • Structure-guided mutagenesis to alter ion selectivity or transport rates.

    • Engineering variants with altered regulatory properties to create constitutively active channels.

    • Development of inhibitor-resistant variants for selective manipulation of specific pools of MRS2-6.

  • Biotechnological applications:

    • Engineering plants with modified MRS2-6 expression or activity to enhance magnesium accumulation for biofortification.

    • Development of MRS2-6 variants that can transport other beneficial minerals.

    • Creation of biosensors for environmental monitoring of bioavailable magnesium .

What insights might comparative studies between plant and human MRS2 transporters provide?

Comparative studies between plant MRS2-6 and human MRS2 could yield valuable insights:

  • Evolutionary conservation and divergence:

    • Detailed sequence and structural comparisons to identify conserved functional domains versus species-specific adaptations.

    • Phylogenetic analysis across diverse organisms to trace the evolutionary history of this ancient transporter family.

    • Identification of plant-specific features that might reflect adaptation to unique cellular environments.

  • Functional complementation studies:

    • Testing whether plant MRS2-6 can restore function in human cells lacking MRS2 and vice versa.

    • Identifying which domains are responsible for species-specific functions through chimeric protein approaches.

  • Comparative structural biology:

    • Leveraging the recent cryo-EM structure of human MRS2 to inform studies of plant MRS2-6.

    • Comparing oligomerization interfaces and potential regulatory sites.

    • Identifying differences in ion selectivity determinants that might reflect different physiological requirements.

  • Differential regulation mechanisms:

    • Comparing how plant and animal MRS2 transporters respond to varying magnesium levels.

    • Identifying regulatory proteins that might be conserved or divergent between kingdoms.

    • Understanding how MRS2 transporters are integrated into kingdom-specific signaling networks.

  • Translational applications:

    • Identifying plant-specific features that might be exploited for agricultural applications.

    • Understanding human disease mutations by testing equivalent changes in the more easily manipulated plant system.

    • Developing screening systems in plants to identify modulators of MRS2 function with potential therapeutic applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.