Recombinant Arabidopsis thaliana Magnesium transporter MRS2-7 (MRS2-7)

Shipped with Ice Packs
In Stock

Description

Overview of MRS2-7

MRS2-7 is a magnesium (Mg²⁺) transporter encoded by the MRS2-7 gene in Arabidopsis thaliana. It belongs to the CorA-MRS2-ALR superfamily of membrane proteins, characterized by a conserved GMN (Gly-Met-Asn) tripeptide motif critical for Mg²⁺ transport . This protein is primarily expressed in root tissues and plays a vital role in Mg²⁺ uptake and homeostasis under low Mg²⁺ environments .

Key Features

  • Gene Family: Part of the MRS2/MGT gene family, which includes 10 members in Arabidopsis.

  • Subcellular Localization: Localized to the endomembrane system, including the endoplasmic reticulum (ER) .

  • Transport Mechanism: Functions as an Mg²⁺ channel, mediating influx into organelles or cytoplasmic compartments .

PropertyDetail
Gene IDAt5g09690 (NCBI)
Alternative NamesMGT7, ATMGT7, F17I14.120
Protein Length386 amino acids (full-length recombinant protein)
Host SystemsE. coli, yeast, mammalian cells (recombinant production)

Role in Magnesium Homeostasis

MRS2-7 is critical for maintaining Mg²⁺ balance under varying concentrations:

  • Low Mg²⁺ Conditions:

    • mrs2-7 knockout mutants exhibit severe growth retardation in hydroponic cultures with 50 μM Mg²⁺ .

    • Overexpression via the CaMV 35S promoter rescues the phenotype and enhances biomass accumulation .

  • High Mg²⁺ Conditions:

    • mrs2-7 mutants show sensitivity to excess Mg²⁺, suggesting a role in Mg²⁺ detoxification or redistribution .

Synergy with Other Transporters

MRS2-7 collaborates with MRS2-4 to regulate Mg²⁺ homeostasis:

MutantPhenotypeConditions
mrs2-7Growth retardation under low Mg²⁺Hydroponic culture
mrs2-4Reduced shoot Mg²⁺ under normal conditionsSoil-grown plants
mrs2-4/mrs2-7Severe growth defects under normal Mg²⁺Soil or hydroponic

Recombinant Protein Applications

Recombinant MRS2-7 is widely used in research for functional studies and antibody production:

Product TypeHostPurityApplications
Full-Length ProteinE. coli≥85% (SDS-PAGE)ELISA, Western blotting
Partial ProteinYeast/mammalian≥85% (SDS-PAGE)Structural studies
AntibodiesRabbitAntigen-affinityImmunodetection

Research Findings and Mechanistic Insights

  • Mg²⁺ Uptake Efficiency:

    • MRS2-7 exhibits high Mg²⁺ uptake efficiency in yeast mitochondrial assays using mag-fura-2 .

    • Complements yeast mrs2 mutants, confirming functional conservation .

  • Tissue-Specific Expression:

    • Restricted to root tissues in seedlings, highlighting its role in initial Mg²⁺ acquisition .

  • Regulatory Mechanisms:

    • Transcript levels are induced under low Mg²⁺ conditions, ensuring adaptive responses .

Comparative Analysis with Homologs

MRS2-7 shares functional and structural similarities with other MRS2/MGT family members:

GeneLocalizationPrimary FunctionKey Phenotype
MRS2-1MitochondriaMg²⁺ uptake for mitochondrial processesComplements yeast splicing defects
MRS2-4Plasma membrane/ERMg²⁺ influx and detoxificationSensitivity to high Ca²⁺
MRS2-7Endomembrane systemRoot Mg²⁺ acquisitionLow Mg²⁺ growth retardation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MRS2-7; MGT7; At5g09690; F17I14.120; Magnesium transporter MRS2-7; Magnesium Transporter 7; AtMGT7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MRS2-7
Target Protein Sequence
MSPDGELVPVDSSAVVTAKRKTSQLSRSWISIDATGQKTVLDVDKHVIMHRVQIHARDLR ILDPNLFYPSAILGRERAIVLNLEHIKAIITAEEVLIRDSSDENVIPVLEEFQRRLPVGN EAHGVHGDGDLGEEDESPFEFRALEVALEAICSFLAARTTELEKFAYPALDELTLKISSR NLERVRKLKSAMTRLTARVQKVRDELEQLLDDDGDMADLYLTRKLVGASSSVSVSDEPIW YPTSPTIGSMISRASRVSLVTVRGDDETDVEELEMLLEAYFMQIDSTLNKLTELREYIDD TEDYINIQLDNHRNQLIQLELMLSAGTVCVSVYSMIAGIFGMNIPNTWNHDHGYIFKWVV SLTGTFCIVLFVIILSYARFRGLIGS
Uniprot No.

Target Background

Function
Recombinant *Arabidopsis thaliana* Magnesium transporter MRS2-7 (MRS2-7) is a low-affinity magnesium transporter mediating magnesium influx.
Gene References Into Functions
  • MRS2-7 is the first identified low-affinity Mg2+ transporter from a higher plant. It is encoded by a gene with alternatively spliced transcripts resulting in proteins with distinct functions. [PMID: 19093971]
  • Overexpression of MRS2-7 enhances biomass accumulation under magnesium-limiting conditions. [PMID: 19966073]
Database Links

KEGG: ath:AT5G09690

STRING: 3702.AT5G09690.2

UniGene: At.32473

Protein Families
CorA metal ion transporter (MIT) (TC 1.A.35.5) family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1 is expressed in the whole plant. Isoform 4 is expressed only in roots and flowers.

Q&A

What is MRS2-7 and what is its role in Arabidopsis thaliana?

MRS2-7 is a member of the MRS2/MGT gene family in Arabidopsis thaliana that functions as a magnesium transporter. This family belongs to the superfamily of CorA-MRS2-ALR-type membrane proteins characterized by a GMN tripeptide motif (Gly-Met-Asn) at the end of the first of two C-terminal transmembrane domains. MRS2-7 plays a crucial role in magnesium supply and distribution after uptake from the soil substrate. Unlike many other gene family member knockouts, a single gene knockout of MRS2-7 results in a strong, environmentally dependent phenotype, particularly showing growth retardation when magnesium concentrations are lowered to 50 μM in hydroponic cultures . This indicates that MRS2-7 has a specialized, non-redundant function in magnesium homeostasis within the plant.

Where is MRS2-7 expressed in Arabidopsis thaliana?

MRS2-7 expression is primarily restricted to the root tissues of Arabidopsis thaliana. This localization pattern has been demonstrated through β-glucuronidase (GUS) reporter gene fusions to the promoter region of MRS2-7. Unlike other MRS2 family members that show expression in multiple plant tissues, MRS2-7 expression is entirely restricted to the root at the seedling stage . This root-specific expression pattern correlates with its functional role in magnesium uptake from the soil and distribution within the plant. The expression of MRS2-7 does not appear to be regulated by environmental magnesium concentrations, as RT-PCR analyses using Arabidopsis plantlets raised on different magnesium concentrations (50, 500, or 1500 μM Mg2+) showed no evidence for magnesium-dependent regulation .

How is MRS2-7 localized within plant cells?

Green fluorescent protein (GFP) reporter gene fusions indicate that MRS2-7 is located in the endomembrane system within plant cells . This subcellular localization differs from some other members of the MRS2 family, which may be targeted to different cellular compartments including plasma membrane, mitochondria, or chloroplasts. Bioinformatic predictions also suggest that MRS2-7 may be localized to the cytoskeleton , although experimental evidence using GFP fusions supports the endomembrane system localization. The specific localization of MRS2-7 is important for its function in magnesium transport and homeostasis within different cellular compartments.

What experimental approaches have been used to characterize MRS2-7 function?

Several complementary experimental approaches have been used to characterize MRS2-7 function:

Experimental ApproachDescriptionKey Findings
Heterologous expression in yeastExpressing MRS2-7 in yeast mrs2 mutants lacking functional magnesium transportersMRS2-7 complements the yeast mrs2 mutant and restores growth on non-fermentable medium (YPdG)
Mag-fura-2 fluorescence assayDirect measurement of Mg2+ uptake using the fluorescent dye mag-fura-2MRS2-7 showed high magnesium uptake efficiency comparable to MRS2-1 and MRS2-10
T-DNA insertion knockout linesCreation of homozygous knockout lines for MRS2-7Strong magnesium-dependent phenotype of growth retardation when Mg2+ concentrations were lowered to 50 μM
Complementation in bacteriaExpression in Salmonella typhimurium mutantsMRS2-7 restored magnesium transport function in bacterial mutants
Overexpression studiesEctopic expression of MRS2-7 from the CaMV 35S promoterComplementation of knockout phenotype and increased biomass accumulation
GFP reporter gene fusionsFusion of MRS2-7 with GFPLocalization to the endomembrane system
Protein-protein interaction studiesYeast mating-based split-ubiquitin system (mbSUS)MRS2-7 can interact with itself and other MRS2 family members

These complementary approaches have provided a comprehensive understanding of MRS2-7 function, localization, and its role in magnesium homeostasis.

How do MRS2-7 knockout mutants respond to different magnesium concentrations?

MRS2-7 knockout mutants exhibit a strong, magnesium-dependent phenotype that varies with external magnesium concentrations:

Magnesium ConcentrationPhenotype in mrs2-7 Knockout Mutants
Standard Mg2+ supplyMild growth retardation, early wilting, but plants develop fully and are fertile
Low Mg2+ (50 μM)Severe growth retardation, significantly reduced biomass accumulation
Elevated Mg2+ supplyImproved growth, amelioration of growth defects

This magnesium-dependent phenotype is specific to mrs2-7 knockouts and is not observed in single-gene knockouts of other MRS2 family members such as MRS2-1, MRS2-5, and MRS2-10, or even in double knockout lines (mrs2-1 mrs2-5 and mrs2-5 mrs2-10) . This indicates a specialized, non-redundant role for MRS2-7 in magnesium homeostasis, particularly under limiting magnesium conditions.

Importantly, the growth retardation phenotype observed in mrs2-7 knockouts under low magnesium conditions can be complemented and even overcompensated by expressing MRS2-7 from the CaMV 35S promoter, leading to increased biomass accumulation compared to wild-type Arabidopsis .

Can MRS2-7 interact with other members of the MRS2/MGT family to form hetero-oligomers?

Yes, protein-protein interaction studies using the yeast mating-based split-ubiquitin system (mbSUS) have demonstrated that MRS2-7 can interact not only with itself but also with other members of the MRS2/MGT family to varying degrees . These interactions could potentially lead to the formation of hetero-oligomers, similar to the pentameric assemblies observed for bacterial CorA magnesium channels.

Key findings regarding MRS2-7 protein interactions include:

  • MRS2-7 demonstrates homologous interactions with itself and heterologous interactions with other MRS2 proteins.

  • Six amino acids may be deleted from the carboxy-terminus and 27 (but not 41) from the amino-terminus of MRS2-7 without impairing these protein-protein interactions .

  • Despite significant sequence diversification among plant MRS2 proteins, they have retained the ancient CorA/MRS2 core structure and the capacity for protein-protein interactions.

The ability to form hetero-oligomers suggests that plant magnesium homeostasis may be influenced by channel formation where different plant MRS2 proteins meet in the same membrane, either naturally or in transgenic approaches . This could provide an additional layer of regulation for magnesium transport and homeostasis.

How does the efficiency of MRS2-7 in magnesium transport compare to other MRS2 family members?

Experimental data using the mag-fura-2 fluorescence assay has revealed variations in magnesium transport efficiency among different MRS2 family members:

MRS2 Family MemberMagnesium Transport Efficiency
MRS2-1High efficiency
MRS2-7High efficiency
MRS2-10High efficiency
MRS2-3Lower efficiency despite good complementation in growth assays
Other MRS2 proteinsVariable but generally lower efficiency

MRS2-7 demonstrated high magnesium uptake efficiency comparable to MRS2-1 and MRS2-10 in direct Mg2+ uptake measurements using mag-fura-2 in isolated yeast mitochondria . This suggests that these three transporters are particularly effective at magnesium transport.

Interestingly, MRS2-3 showed good complementation in growth assays but relatively low magnesium uptake in the mag-fura-2 assay. This discrepancy suggests that MRS2-3 may act as a comparatively slow transporter for Mg2+, allowing for ion homeostasis over longer periods (hours) but not showing measurable transport over shorter time intervals (minutes) .

These differences in transport efficiency may reflect the specialized roles of different MRS2 family members in various tissues and cellular compartments.

What are the structural differences between human MRS2 and plant MRS2-7 that might affect function?

Human MRS2 and plant MRS2-7 share common structural features as members of the CorA-MRS2-ALR superfamily, but also exhibit important differences that may affect their function:

FeatureHuman MRS2Plant MRS2-7
Oligomeric structureHomo-pentameric Potential homo-pentameric or hetero-oligomeric with other MRS2 proteins
Gating residuesR332 and M336 identified as major gating residues Specific gating residues not yet characterized
Mg2+ binding sitesTwo Mg2+ binding sites in the soluble domain, distinct from those in prokaryotic CorA Mg2+ binding sites not fully characterized
Subcellular localizationInner mitochondrial membrane Endomembrane system
Regulatory networkHydrogen bond network connecting gating residue R332 to the soluble domain Regulatory mechanisms not fully characterized

The human MRS2 structure determined by cryo-EM at 2.8 Å resolution in the presence of Mg2+ has provided detailed insights into its mechanism . Similar high-resolution structural studies of plant MRS2-7 would be valuable for understanding its specific mechanism of action and how it differs from the human counterpart.

These structural differences likely contribute to the specialized functions of MRS2 proteins in different organisms and cellular contexts.

How can researchers manipulate MRS2-7 expression to study its role in magnesium homeostasis?

Researchers can employ several strategies to manipulate MRS2-7 expression for studying its role in magnesium homeostasis:

ApproachMethodologyApplications
T-DNA insertion knockout linesGenerate homozygous knockout lines using available T-DNA insertion collectionsStudy loss-of-function effects on plant growth and magnesium homeostasis
Ectopic overexpressionExpress MRS2-7 from the CaMV 35S promoterStudy gain-of-function effects and potential for improving plant growth under magnesium-limiting conditions
Tissue-specific expressionUse tissue-specific promoters to drive MRS2-7 expressionDetermine the importance of MRS2-7 in different plant tissues
Structure-function analysisGenerate mutants with altered GMN motif or other key residuesIdentify critical residues for magnesium transport function
Reporter gene fusionsFuse MRS2-7 with GFP, GUS or other reportersStudy subcellular localization and expression patterns
Multiple gene knockoutsCreate double or triple knockouts with other MRS2 family membersStudy functional redundancy and compensatory mechanisms
Heterologous expressionExpress MRS2-7 in yeast or bacterial mutants lacking magnesium transportersValidate transport function and compare with other transporters

These approaches have already yielded valuable insights into MRS2-7 function. For example, mrs2-7 knockout lines show severe growth retardation under limiting magnesium conditions (50 μM Mg2+), while ectopic overexpression from the CaMV 35S promoter not only complements this phenotype but leads to increased biomass accumulation compared to wild-type plants .

When designing experiments to manipulate MRS2-7, researchers should consider variables such as magnesium concentration in growth media, potential interactions with calcium and other divalent cations, and the possibility of compensatory mechanisms involving other magnesium transporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.