Recombinant Arabidopsis thaliana Mechanosensitive ion channel protein 2, chloroplastic (MSL2)

Shipped with Ice Packs
In Stock

Description

Functional Insights from Mutational Studies

Research highlights the role of conserved motifs in MSL2’s mechanosensitive activity:

  • PN(X)₉N motif: Essential for plastid localization and function. Mutations here disrupt plastid morphology .

  • Pore-lining residues: Substituting hydrophobic residues (e.g., L109S, V113S) creates gain-of-function alleles, leading to chloroplast rupture and starch accumulation .

  • Ion flux regulation: MSL2 modulates plastid size and shape by responding to membrane tension, akin to bacterial MscS channels .

Role in Plastid Dynamics

MSL2 collaborates with MSL3 to maintain plastid integrity:

  • Mutant phenotypes: msl2msl3 mutants exhibit enlarged, spherical plastids, variegated leaves, and disrupted mesophyll cell organization .

  • Localization: MSL2 localizes to plastid envelope foci, colocalizing with plastid division proteins like AtMinE .

Table 2: Key Research Findings on MSL2 Mutants

PhenotypeMechanism ImplicatedCitations
Abnormal plastid shapeLoss of ion flux regulation under membrane tension
Leaf variegationDisrupted chloroplast division and starch metabolism
Cell growth defectsGain-of-function alleles causing ion leakage

Comparative Analysis with Bacterial Homologs

MSL2 shares functional parallels with E. coli MscS:

  • Osmotic protection: MSL3 (a homolog) rescues osmotic sensitivity in E. coli mutants lacking MscS .

  • Evolutionary divergence: Unlike bacterial MscS, MSL2 influences plastid division via Min system interactions, suggesting plant-specific adaptations .

Applications in Research

Recombinant MSL2 facilitates:

  • Mechanotransduction studies: Patch-clamp electrophysiology to characterize channel gating .

  • Protein interaction assays: Investigating partnerships with plastid division machinery (e.g., FtsZ, MinE) .

  • Mutational screens: Identifying residues critical for ion selectivity and tension sensing .

Challenges and Future Directions

Current limitations include unresolved structures of full-length MSL2 and incomplete understanding of its regulation. Future work may leverage cryo-EM or in planta optogenetic tools to dissect real-time channel dynamics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MSL2; At5g10490; F12B17.160; Mechanosensitive ion channel protein 2, chloroplastic; Mechanosensitive channel of small conductance-like 2; MscS-Like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
76-673
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MSL2
Target Protein Sequence
CHSFSASGKAIEPAVKAVTVVLTKSHGLMQQFPFVYKLVPAVALLVFSLWGLVPFARQGR NILLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALDPVVLPTEASKIVKDRLLNF VRSLSTVLAFAYCLSSLIQQTQKLFSETSNPSDTRNMGFQFAGKALYSAVWVAAVSLFME LLGFSTQKWLTAGGLGTVLITLAGREILTNFLSSVMIHATRPFVLNEWIQTKIEGYEVSG TVEHVGWWSPTIIRGEDREAIHIPNHKFTVNVVRNLTQKTHWRIKTHLAISHLDVNKINN IVADMRKVLAKNPMVEQQRLHRRVFLENVIPENQALSILISCFVKTSHHEEYLGVKEAIL LDLLRVISHHRARLATPIRTIRKMYTETDVENTPFGESMYGGVTSRRPLMLIEPAYKING EDKSKSQNRAAKPTAEQENKGSNPKSKETSSPDLKANVKVGESPVSDTNKVPEETVAKPV IKAVSKPPTPKDTETSGTEKPKAKRSGGTIKSTKTDETDSSTSSASRSTLEENIVLGVAL EGSKRTLPIEEEIHSPPMETDAKELTGARRSGGNGPLVADKEQKDSQSQPNSGASTEP
Uniprot No.

Target Background

Function
Mechanosensitive channel that opens in response to stretch forces in the membrane lipid bilayer. It controls plastid size, shape, and possibly division during normal plant development by regulating ion flux in response to changes in membrane tension. It acts as a component of the chloroplast division machinery.
Gene References Into Functions
  1. Two of the three conserved motifs are critical for MSL2 function, supporting the conservation of structure and function between MscS family members in bacteria and plants. PMID: 22768278
  2. MSL2, MSL3, and components of the Min system function in the same pathway to regulate chloroplast size and FtsZ ring formation. PMID: 21810996
  3. Our research indicates that plastids experience hypoosmotic stress during normal plant growth, and dynamic response to this stress requires MSL2 and MSL3. PMID: 22326022
  4. Two MscS-like proteins, MSL2 and MSL3, regulate ion flux in response to changes in membrane tension, controlling plastid size, shape, and potentially division during normal plant development. [MSL2] PMID: 16401419
Database Links

KEGG: ath:AT5G10490

STRING: 3702.AT5G10490.1

UniGene: At.48016

Protein Families
MscS (TC 1.A.23) family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the functional role of MSL2 in Arabidopsis thaliana?

MSL2 functions as a mechanosensitive ion channel localized to the plastid envelope in Arabidopsis thaliana. Working alongside its homolog MSL3, it serves as an osmotic "safety valve" that maintains plastid osmotic homeostasis during normal growth and development. MSL2 is required for normal plastid size, shape, and division site selection . Experimental evidence demonstrates that plants lacking functional MSL2 and MSL3 develop variegated leaves, enlarged chloroplasts, and large, spherical leaf epidermal plastids that cannot properly adjust their volume in response to extreme osmotic shock .

How is MSL2 structurally organized?

MSL2 has a complex structural organization consisting of:

  • Five predicted transmembrane (TM) helices

  • An extensive C-terminal domain predicted to be located in the stroma

  • A critical PN(X)9N motif at the top of the cytoplasmic domain, essential for proper function and localization

  • A pore-lining transmembrane helix containing important hydrophobic residues

This structural arrangement allows MSL2 to function as a mechanosensitive channel that responds to changes in membrane tension caused by osmotic stress.

What phenotypes are associated with MSL2 deficiency?

The null allele of MSL2 (msl2-3) produces distinctive phenotypes that are readily identifiable:

Phenotypic TraitWild Typemsl2-3 Mutantmsl2 msl3 Double Mutant
Plant SizeNormalSlightly smallerSignificantly smaller
Leaf MorphologySmooth edgesNotched edges, rumpled surfaceLobed periphery, severely rumpled surface
Plastid MorphologyNormal size and shapeEnlargedGrossly enlarged, round, unable to adjust volume
Mesophyll OrganizationOrganizedSlightly disturbedSeverely disturbed
Shoot ApexNormal meristemAffectedCallus formation

These phenotypes can be rescued by expression of the MSL2g transgene, confirming their specific association with MSL2 deficiency .

How can researchers generate and validate recombinant MSL2 proteins?

To generate recombinant MSL2 protein:

  • Cloning Strategy:

    • Amplify the MSL2 coding sequence from Arabidopsis cDNA

    • Insert into an appropriate expression vector (e.g., pET-28a for bacterial expression)

    • Include a purification tag (His-tag or GST-tag)

  • Expression System Selection:

    • E. coli systems (BL21(DE3)) work well for basic structural studies

    • Plant-based expression systems may be preferable for functional studies requiring proper folding and post-translational modifications

  • Protein Purification Protocol:

    • Solubilize membrane proteins using appropriate detergents (e.g., n-dodecyl-β-D-maltoside)

    • Use affinity chromatography followed by size exclusion chromatography

    • Validate protein integrity through Western blotting using MSL2-specific antibodies

  • Functional Validation:

    • Conduct reconstitution experiments in liposomes

    • Measure channel activity using electrophysiological techniques similar to those used with MscS in bacteria

What methods are effective for studying MSL2 localization and dynamics?

Several complementary approaches provide comprehensive insights into MSL2 localization:

  • Fluorescent Protein Fusion:

    • Generate MSL2-GFP or MSL2-RFP fusion constructs

    • Transform into wild-type or msl2 mutant plants

    • Visualize using confocal microscopy

    • The RecA-dsRED marker has been successfully used to visualize plastids in MSL2 studies

  • Immunolocalization:

    • Fix plant tissues and perform immunolocalization using MSL2-specific antibodies

    • Combine with organelle markers for co-localization studies

  • Subcellular Fractionation:

    • Isolate intact chloroplasts from Arabidopsis leaves

    • Further fractionate to separate envelope membranes from stromal and thylakoid components

    • Analyze fractions by Western blotting for MSL2 presence

  • Super-Resolution Microscopy:

    • Employ techniques like STORM or PALM for nanoscale resolution of MSL2 distribution

    • Useful for studying dynamic clustering or redistribution under stress conditions

How do specific domains of MSL2 contribute to its mechanosensitive properties?

Structure-function analysis has identified critical motifs in MSL2 that are essential for its mechanosensitive properties:

  • PN(X)9N Motif:

    • Located at the top of the cytoplasmic domain

    • Essential for proper function and intraplastidic localization

    • Mutation of this motif disrupts MSL2 function without affecting protein stability

  • Pore-Lining Transmembrane Helix:

    • Contains large hydrophobic residues critical for channel gating

    • Substituting these with polar residues produces a gain-of-function phenotype

    • Similar to effects observed in bacterial MscS channels, suggesting evolutionary conservation of gating mechanisms

  • C-Terminal Domain:

    • Extensive region predicted to be in the stroma

    • Contains regions implicated in sensing membrane tension

    • May interact with other plastid proteins to regulate channel activity

Understanding these structure-function relationships provides opportunities for engineering MSL2 variants with altered mechanosensitive properties for experimental applications.

What experimental approaches can distinguish between MSL2 functions and those of its homolog MSL3?

Despite their partially redundant functions, MSL2 and MSL3 have distinct roles that can be investigated through:

  • Genetic Complementation Series:

    • Generate transgenic plants expressing MSL2 in msl3 background and vice versa

    • Quantify the degree of phenotypic rescue to assess functional overlap

    • Create chimeric proteins with domains swapped between MSL2 and MSL3 to identify domain-specific functions

  • Differential Expression Analysis:

    • Use RNA-Seq to compare transcriptional responses in single and double mutants

    • Identify genes specifically regulated by each channel

    • Analysis of msl2msl3 mutants has revealed distinctive transcriptional signatures compared to other plastid mutants

  • Tissue-Specific Expression Patterns:

    • Generate promoter-reporter constructs to map expression domains

    • Use immunolocalization with specific antibodies to detect differential localization

    • Correlate expression patterns with tissue-specific phenotypes

  • Electrophysiological Characterization:

    • Perform patch-clamp analysis of reconstituted channels

    • Compare conductance, ion selectivity, and gating thresholds

    • Determine unique biophysical properties of each channel

How can MSL2 function be manipulated to study chloroplast stress responses?

MSL2 provides a valuable experimental tool for studying plastid stress responses:

  • Inducible Expression Systems:

    • Generate lines with MSL2 under control of inducible promoters (e.g., dexamethasone, estradiol)

    • Create gain-of-function variants by substituting polar residues for hydrophobic residues in the pore-lining transmembrane helix

    • Monitor acute responses to altered plastid osmotic status

  • Integration with Other Stress Pathways:

    • Combine MSL2 manipulation with treatments affecting other stress response pathways

    • Analyze additive, synergistic, or antagonistic interactions

    • The relationship between plastid osmotic stress and hormone signaling can be investigated, as shown by the effects of synthetic auxin (NAA) on msl2 msl3 mutant phenotypes

  • Experimental Protocol for Osmotic Challenge Assays:

    • Culture plants on medium containing varying concentrations of osmolytes (NaCl, mannitol)

    • Transfer plants between media with different osmotic potentials at specific developmental stages

    • Quantify physiological responses (plastid morphology, gene expression)

    • Previous experiments demonstrated that NaCl treatment can suppress msl2 msl3 phenotypes when applied during a specific developmental window (before 2 days after germination)

What is the relationship between MSL2-mediated plastid osmotic stress and plant development?

The developmental implications of MSL2 function present fascinating research opportunities:

  • Plastid-Nuclear Signaling Analysis:

    • Compare transcriptome data from msl2msl3 mutants with other plastid mutants

    • Identify common and distinct signaling pathways

    • RNA-Seq analysis of msl2msl3, ggps1, and crl mutants has revealed that while some gene expression changes are shared, many are unique to each plastid dysfunction pathway

  • Hormone Level Quantification:

    • Measure levels of key phytohormones in MSL2 mutants

    • Elevated trans-zeatin-riboside levels (approximately 6.5-fold increase) have been observed in msl2 msl3 mutants

    • Analyze spatial distribution of hormones using reporter constructs

  • Shoot Apical Meristem (SAM) Analysis Protocol:

    • Prepare thin sections of the SAM from wild-type and mutant plants

    • Perform histological staining to visualize cellular organization

    • Use transmission electron microscopy to examine plastid ultrastructure

    • msl2 msl3 mutants display a cluster of disorganized cells with abnormal morphology at the SAM

  • Developmental Stage-Specific Complementation:

    • Create MSL2 constructs under control of tissue-specific or developmentally regulated promoters

    • Determine critical tissues and developmental windows for MSL2 function

    • Previous work established a narrow developmental window (before 2 DAG) during which NaCl treatment can suppress developmental defects in msl2 msl3 mutants

How can researchers overcome common challenges in MSL2 expression and purification?

Membrane protein manipulation presents several challenges that require specific approaches:

  • Addressing Poor Protein Solubility:

    • Optimize detergent selection (try CHAPS, DDM, or digitonin at varying concentrations)

    • Test different solubilization temperatures (4°C, room temperature)

    • Consider fusion partners that enhance solubility (MBP, SUMO)

    • Explore nanodiscs or amphipols as alternatives to detergents for maintaining native structure

  • Improving Protein Stability:

    • Add glycerol (5-10%) to all buffers

    • Include specific lipids that might stabilize the protein

    • Test different pH conditions and buffer systems

    • Consider adding osmolytes like trehalose or sucrose

  • Addressing Inconsistent Activity:

    • Ensure proper refolding if using denaturation-renaturation protocols

    • Verify oligomeric state using size exclusion chromatography

    • Confirm orientation in reconstituted systems

    • Test functionality in lipid compositions that mimic the plastid envelope

What controls are essential when analyzing MSL2 mutant phenotypes?

Rigorous experimental design requires appropriate controls:

  • Genetic Background Controls:

    • Use multiple independent mutant alleles when available

    • Ensure backcrossing to eliminate background mutations

    • Include complementation with wild-type MSL2 gene (MSL2g) to confirm phenotype causality

  • Environmental Variable Control Protocol:

    • Standardize growth conditions (light intensity, photoperiod, temperature)

    • Use climate-controlled growth chambers to minimize variation

    • Plant genotypes in randomized block designs

    • Document position effects within growth facilities

  • Developmental Staging:

    • Define precise developmental stages for analysis

    • Use both chronological (days after germination) and morphological criteria

    • The developmental window for NaCl suppression of msl2 msl3 phenotypes highlights the importance of precise staging in experiments

  • Quantitative Phenotyping Methods:

    • Develop objective metrics for phenotype quantification

    • Use image analysis software for consistent measurement

    • Establish clear scoring rubrics for categorical phenotypes

    • Blind scoring procedures to prevent observer bias

What emerging technologies will advance our understanding of MSL2 function?

Several cutting-edge approaches show promise for MSL2 research:

  • Cryo-EM Structure Determination:

    • Apply single-particle cryo-EM to determine high-resolution structure

    • Compare with bacterial MscS structures to identify conserved and divergent features

    • Capture multiple conformational states to understand gating mechanism

  • Optogenetic Control of MSL2 Activity:

    • Engineer light-sensitive domains into MSL2

    • Enable precise spatiotemporal control of channel opening

    • Study immediate consequences of altered plastid osmotic status

  • CRISPR-Based Approaches:

    • Generate targeted mutations in specific MSL2 domains

    • Create MSL2 variants with altered function rather than complete loss-of-function

    • Explore base editing to introduce specific amino acid changes without donor templates

  • Single-Cell Transcriptomics:

    • Apply to dissect cell-type specific responses to MSL2 dysfunction

    • Identify cell populations most sensitive to plastid osmotic stress

    • Map developmental trajectories altered by MSL2 mutation

How might MSL2 research inform our understanding of plant adaptation to environmental stresses?

MSL2 research has broader implications for plant stress biology:

  • Climate Change Adaptation Studies:

    • Investigate MSL2 function under fluctuating temperature and water availability

    • Determine if natural variation in MSL2 correlates with stress tolerance

    • Develop MSL2 variants with enhanced function under stress conditions

  • Cross-Species Comparative Analysis:

    • Compare MSL2 structure and function across plant species adapted to different environments

    • Identify evolutionary adaptations in MSL2 that correlate with stress tolerance

    • Potential experimental design could include:

      • Cloning MSL2 orthologs from diverse plant species

      • Testing complementation of Arabidopsis msl2 mutants

      • Measuring functional parameters in heterologous systems

  • Integration with Metabolic Networks:

    • Map connections between plastid osmotic homeostasis and metabolic pathways

    • Investigate how MSL2 dysfunction impacts photosynthetic efficiency

    • Explore relationships between plastid stress and cellular energy status

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.