Recombinant Arabidopsis thaliana Metal tolerance protein 10 (MTP10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Metal Tolerance Protein 10 (MTP10)

Recombinant Arabidopsis thaliana Metal Tolerance Protein 10 (MTP10) is a crucial protein involved in maintaining metal homeostasis in plants. It belongs to the Cation Diffusion Facilitator (CDF) family, which plays a significant role in transporting divalent metal ions across cellular membranes. MTP10 has been identified as a key regulator in maintaining the balance between magnesium (Mg²⁺) and calcium (Ca²⁺) ions, which are essential for plant growth and development.

Key Findings:

  • Mg²⁺ and Ca²⁺ Homeostasis: MTP10 helps regulate the balance between Mg²⁺ and Ca²⁺, which is vital for plant development. High Mg²⁺ levels can inhibit Ca²⁺ uptake, while Ca²⁺ can mitigate the adverse effects of excess Mg²⁺ on plant growth .

  • Transport Activity: Although MTP10 does not directly transport Ca²⁺, its activity influences Ca²⁺ uptake indirectly by managing Mg²⁺ levels .

Growth Assays

Studies have shown that the mtp10 mutant exhibits severe growth retardation when exposed to high Mg²⁺ concentrations. This phenotype can be rescued by adding Ca²⁺ to the growth medium, highlighting the antagonistic relationship between Mg²⁺ and Ca²⁺ .

ConditionWild-Type Growthmtp10 Mutant Growth
Normal MediumNormal GrowthNormal Growth
High Mg²⁺ MediumReduced GrowthSevere Growth Retardation
High Mg²⁺ + Ca²⁺ MediumNormal GrowthRescued Growth

ICP-MS Analysis

Inductively Coupled Plasma Mass Spectrometry (ICP-MS) data confirm that the addition of Ca²⁺ reduces excessive Mg²⁺ accumulation, while high Mg²⁺ levels inhibit Ca²⁺ uptake .

Ion ConcentrationWild-Type Plantsmtp10 Mutant Plants
Mg²⁺ (High)Balanced UptakeExcessive Accumulation
Ca²⁺ (Normal)Normal UptakeReduced Uptake
Ca²⁺ (Added)Enhanced UptakeRescued Uptake

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please communicate this to us, and we will prioritize development of the specified tag.
Synonyms
MTP10; At1g16310; F3O9.11; Metal tolerance protein 10; AtMTP10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTP10
Target Protein Sequence
MPLNSYIFFLFLTTSPRNTFFGIRTHSDRIMATEHITRTGDEYNVELLPSDDDAPPLESS WRLNLDAFQLPSSTGGRHDGRTRFSRYFRTPRKERRVSEYYKKQERLLEGFNEMETIHEN GFASGVPTEEEMKKLAKSERLAVHISNATNLVLFVAKVYASMESRSMAVIASTLDSLLDL LSGFILWFTANAMRKPNQFHYPIGKRRMQPVGIIVFASVMATLGLQVLLESGRQLVAKSG IHMNSTEEKWMIGIMVSVTIVKFLLMLYCRGFQNEIVRAYAQDHLFDVVTNSIGLATAVL AVKFYWWIDPTGAILIALYTIATWARTVLENVHSLIGRSAPPDFLAKLTFLIWNHHEQIK HIDTVRAYTFGSHYFVEVDIVLPEDMRLQEAHNIGETLQEKLEQLAEVERAFVHIDFEFT HRPEHKCN
Uniprot No.

Target Background

Function
Metal tolerance protein 10 (MTP10) is involved in sequestering excess metal from the cytoplasm into vacuoles, ensuring metal homeostasis in Arabidopsis thaliana.
Database Links

KEGG: ath:AT1G16310

STRING: 3702.AT1G16310.1

UniGene: At.28496

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is MTP10 and what is its functional classification?

MTP10 (Metal Tolerance Protein 10) is a member of the CDF (Cation Diffusion Facilitator) family in Arabidopsis thaliana. It functions as a proton/divalent cation transporter responsible for the efflux of cations from the cytoplasm to the extracellular space or their transport from the cytoplasm to subcellular organelles . MTP10 has been specifically identified as a crucial regulator of magnesium (Mg) and calcium (Ca) homeostasis in Arabidopsis . The protein consists of 428 amino acids and is encoded by the At1g16310 gene locus (also known as F3O9.11) .

How does MTP10 differ from other MTP family members in Arabidopsis?

Arabidopsis contains 12 MTP genes, but interestingly, only the knockout of MTP10 has been shown to significantly decrease tolerance to high-Mg stress . While most functionally characterized MTP transporters can transport various divalent metal ions such as Zn²⁺, Mn²⁺, Co²⁺, and Ni²⁺ , MTP10 appears to have a more specialized function in Mg²⁺ transport. Despite previous studies suggesting MTP10 could transport Mn²⁺, more recent research confirms that plasma membrane-localized MTP10 can transport Mg²⁺ in bacterial systems and plays a crucial role in magnesium homeostasis .

What is the subcellular localization of MTP10 and how does this relate to its function?

MTP10 is primarily localized to the plasma membrane of parenchyma cells surrounding the xylem in Arabidopsis . This specific localization is critical to its function, as it facilitates Mg²⁺ diffusion from the xylem to shoot tissues, thereby regulating Mg homeostasis in shoot vascular tissues . The plasma membrane localization of MTP10 distinguishes it from some other MTP family members that may be localized to organelle membranes, highlighting its unique role in cation transport between vascular tissues and surrounding cells.

What methods are recommended for analyzing MTP10 expression patterns in different tissues?

For analyzing MTP10 expression patterns, Quantitative RT-PCR (qRT-PCR) is a recommended approach. Based on published protocols, researchers should:

  • Grow Arabidopsis (wild-type Col-0 and mtp10 mutant) seedlings in 1/2 MS agar medium for 7 days

  • Transfer to 1/6 MS liquid medium for another 7 days

  • Treat seedlings with high-Mg (1/6 MS+10 mM MgCl₂) for 10 hours

  • Isolate total RNA using Trizol reagent and treat with DNase I

  • Synthesize first-strand cDNA with M-MLV Reverse Transcriptase using oligo dT primers

  • Perform qRT-PCR using SYBR Green I Master mix

  • Use ACTIN2 (At3g18730) as an internal standard

This method enables quantitative assessment of MTP10 expression in response to various environmental conditions, particularly high magnesium stress.

How can researchers effectively generate and validate recombinant MTP10 protein for functional studies?

A methodological approach for generating recombinant MTP10 includes:

  • Clone the full-length CDS of MTP10 into an appropriate expression vector (e.g., pYES2 for yeast expression or an E. coli expression vector with His-tag)

  • Transform the construct into E. coli expression strains

  • Induce protein expression and purify using affinity chromatography

  • Validate protein integrity through SDS-PAGE (>90% purity recommended)

  • Store the lyophilized protein with 6% Trehalose in Tris/PBS buffer at pH 8.0

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C

For functional validation, heterologous expression systems are valuable, particularly the Mg-uptake-deficient bacterial strain MM281, which has confirmed MTP10's ability to transport Mg²⁺ .

What are effective approaches for studying protein-protein interactions involving MTP10?

Yeast two-hybrid (Y2H) assay is a well-established method for studying MTP10 protein interactions:

  • Clone the non-transmembrane C-terminal region sequence of MTP10 into the vector pGADT7

  • Clone the CDS sequence of potential interacting proteins (e.g., CIPKs) into the vector pGBKT7

  • Transform fusion constructs into yeast strain AH109 using the lithium acetate transformation method

  • Grow transformants in synthetic dropout medium lacking tryptophan and leucine

  • Test interactions by growing on synthetic dropout medium lacking tryptophan, leucine, histidine, and adenine at different dilutions (10⁻¹, 10⁻², and 10⁻³ cells/ml) at 30°C

This approach is particularly useful for identifying regulatory proteins that may interact with the cytosolic domains of MTP10 to modulate its function.

How does MTP10 contribute to calcium and magnesium homeostasis in Arabidopsis?

MTP10 plays a crucial role in maintaining the homeostasis of both Mg²⁺ and Ca²⁺ in Arabidopsis through several mechanisms:

  • It facilitates Mg²⁺ diffusion from the xylem to shoot tissues, regulating Mg distribution in the plant

  • The mtp10 mutant exhibits severe growth retardation under high Mg²⁺ conditions, indicating its essential role in Mg²⁺ tolerance

  • External Ca²⁺ supplementation can rescue the high-Mg sensitive phenotype of the mtp10 mutant in a dosage-dependent manner

  • Ca²⁺ deficiency exacerbates the high-Mg sensitivity of the mtp10 mutant

These observations confirm an antagonistic relationship between Ca²⁺ and Mg²⁺, with MTP10 serving as a key regulator in maintaining this balance. The addition of Ca²⁺ reduces excessive Mg²⁺ accumulation, while high-Mg conditions inhibit Ca²⁺ uptake .

What phenotypic assays are most informative for studying mtp10 mutant plants?

The following phenotypic assays have proven most informative for characterizing mtp10 mutants:

  • Growth assays under varied cation concentrations:

    • Compare seedling growth on media with increasing Mg²⁺ concentrations (0-10 mM MgCl₂)

    • Measure fresh weight and primary root length after 7-14 days

    • Test rescue effect by supplementing with various Ca²⁺ concentrations (0.15-3.53 mM)

  • Mineral content analysis:

    • Use Inductively Coupled Plasma Mass Spectrometry (ICP-MS) to quantify Mg²⁺ and Ca²⁺ contents

    • Compare ion accumulation in shoots versus roots

    • Analyze xylem sap composition under control and high-Mg stress conditions

  • Reciprocal grafting experiments:

    • Perform wild-type/mutant reciprocal grafting to determine tissue-specific function

    • Assess whether shoot or root expression of MTP10 is required for normal growth

These assays collectively provide comprehensive data on how MTP10 influences plant development and ion homeostasis under various stress conditions.

How do researchers investigate the transport mechanism and ion selectivity of MTP10?

Investigating MTP10's transport mechanism and ion selectivity requires multiple complementary approaches:

  • Heterologous expression systems:

    • Express MTP10 in the yeast mutant Δgdt1 and assess growth under varying Ca²⁺ concentrations (0, 100, 200, or 300 mM)

    • Compare with wild-type yeast strain BY4741 as control

    • Use the bacterial strain MM281 (Mg²⁺-uptake-deficient) system to test specific Mg²⁺ transport capability

  • Electrophysiological studies:

    • Perform patch-clamp analysis on cells expressing MTP10 to characterize ion conductance

    • Measure membrane potential changes in response to different ion concentrations

  • Site-directed mutagenesis:

    • Generate mutations in predicted ion-binding or transport domains

    • Assess how these mutations affect transport function and ion selectivity

  • Ion competition assays:

    • Test transport activities in the presence of competing ions to determine selectivity

These approaches collectively provide insights into the biophysical properties of MTP10-mediated transport and its ion preferences.

What methodological approaches help resolve conflicting data about MTP10's ability to transport different metal ions?

When addressing contradictory findings regarding MTP10's transport capabilities (e.g., previously reported Mn²⁺ transport versus more recent Mg²⁺ transport data), researchers should:

  • Perform comparative transport assays:

    • Test transport of multiple ions (Mg²⁺, Ca²⁺, Mn²⁺) in parallel using the same expression system

    • Quantify transport rates for each ion under standardized conditions

    • Generate competition curves to assess relative affinities

  • Analyze structure-function relationships:

    • Compare MTP10 sequence with better-characterized transporters

    • Identify conserved domains associated with specific ion selectivity

    • Create chimeric proteins with domains from different transporters to pinpoint selectivity determinants

  • Use advanced imaging techniques:

    • Employ fluorescent metal ion indicators to visualize real-time transport in living cells

    • Compare subcellular localization of different metal ions in wild-type versus mtp10 mutant cells

  • Implement rigorous controls:

    • Include positive controls for each ion tested

    • Account for potential indirect effects by using alternative transport inhibitors

    • Consider the influence of experimental conditions (pH, temperature, competing ions)

This systematic approach helps reconcile apparently contradictory findings about MTP10's transport specificity.

How might understanding MTP10 function contribute to improving plant nutrient efficiency and stress tolerance?

Understanding MTP10 function has several potential applications for crop improvement:

  • Engineering improved nutrient utilization:

    • Modifying MTP10 expression could optimize Mg²⁺ distribution within plant tissues

    • Balancing Ca²⁺/Mg²⁺ ratios may enhance growth in soils with suboptimal mineral composition

    • Targeted expression could improve nutrient allocation to edible plant parts

  • Enhancing abiotic stress tolerance:

    • Since MTP10 mediates tolerance to high Mg²⁺ conditions, engineered variants might improve plant growth in magnesium-rich soils

    • The observed antagonistic relationship between Ca²⁺ and Mg²⁺ mediated by MTP10 could be exploited to develop crops with improved tolerance to Ca²⁺ deficiency

  • Biofortification strategies:

    • Manipulating MTP10 activity could potentially enhance mineral content in edible tissues

    • This approach may help address human mineral deficiencies through diet

These applications would require translating findings from Arabidopsis to crop species, considering homologous genes and potentially similar regulatory mechanisms.

What experimental design would be appropriate for investigating MTP10 homologs in crop species?

An effective experimental design for investigating MTP10 homologs in crop species would include:

  • Homolog identification and characterization:

    • Perform phylogenetic analysis to identify putative MTP10 homologs

    • Analyze gene structure, protein domains, and expression patterns

    • Compare with Arabidopsis MTP10 to identify conserved features

  • Functional validation:

    • Generate CRISPR/Cas9 knockout mutants of identified homologs

    • Perform complementation assays by expressing crop MTP10 homologs in Arabidopsis mtp10 mutants

    • Analyze phenotypes under control and high-Mg²⁺ conditions

  • Expression analysis:

    • Quantify expression levels in different tissues and developmental stages

    • Assess expression responses to various mineral stresses

    • Use reporter gene fusions to visualize tissue-specific expression

  • Agronomic evaluation:

    • Grow mutant and wild-type plants under field conditions with varying soil Mg²⁺ levels

    • Measure yield components, mineral content, and stress resilience

    • Create a data table comparing growth parameters across genotypes and conditions:

GenotypeNormal SoilHigh-Mg SoilLow-Ca SoilCombined Stress
Wild-typeBaselineModerate stressModerate stressSevere stress
mtp10 mutantNormalSevere stressSevere stressLethal stress
ComplementedNormalModerate stressModerate stressSevere stress
OverexpressorNormalMild stressMild stressModerate stress

This systematic approach would help translate knowledge from Arabidopsis to crop improvement applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.