Recombinant Arabidopsis thaliana Metal tolerance protein 11 (MTP11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant MTP11

Recombinant Arabidopsis thaliana Metal Tolerance Protein 11 (MTP11) is a cation diffusion facilitator (CDF) protein engineered for functional and structural studies. Native MTP11 (UniProt ID: O80632) is encoded by the At2g39450 gene and plays a critical role in manganese (Mn) homeostasis and detoxification in plants. The recombinant version is typically expressed in E. coli with an N-terminal His-tag for purification and is used to investigate its transport mechanisms, subcellular localization, and biotechnological applications .

PropertyDetail
Gene LocusAt2g39450
Protein LengthFull-length (1–394 amino acids)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with 50% glycerol for stability

Key Functional Insights

  • Manganese Transport: MTP11 confers Mn tolerance in yeast by exporting Mn via a proton antiport mechanism . In Arabidopsis, it localizes to pre-vacuolar/Golgi compartments, suggesting Mn detoxification through vesicular trafficking and exocytosis .

  • Mutant Phenotypes: Arabidopsis mtp11 mutants are hypersensitive to Mn, while overexpression enhances tolerance .

  • Cross-Species Complementation: Rice OsMTP11 rescues the Mn-sensitive phenotype of Arabidopsis mtp11-3 mutants, demonstrating functional conservation .

StudyFindingsSource
Yeast ComplementationConfers Mn tolerance via proton antiport; slight Zn transport observed
Subcellular LocalizationGolgi/pre-vacuolar compartments in Arabidopsis and rice
Mutagenesis (OsMTP11)D162A and D267H mutations abolish Mn transport; L150S enhances activity

Research Applications and Biotechnological Potential

Recombinant MTP11 is pivotal for elucidating Mn homeostasis and developing strategies to mitigate metal toxicity in crops.

Experimental Uses

  • Functional Studies:

    • Yeast Assays: Validate Mn transport activity and proton antiport mechanisms .

    • Site-Directed Mutagenesis: Identify critical residues (e.g., D162, D267) for Mn binding .

  • Localization Tracking: Fluorescent tagging (e.g., GFP) confirms Golgi-associated trafficking .

Agricultural Implications

  • Crop Improvement: Overexpression of MTP11 could enhance Mn tolerance in Mn-rich soils, reducing toxicity .

  • Phytoremediation: Engineering hyperaccumulators to sequester Mn using MTP11 variants .

Production and Handling Guidelines

Recombinant MTP11 is produced under controlled conditions to ensure stability and activity.

ParameterRecommendation
Storage-20°C/-80°C in aliquots; avoid repeated freeze-thaw cycles
ReconstitutionDeionized water (0.1–1.0 mg/mL) + 50% glycerol for long-term storage
Purity AssuranceSDS-PAGE verification (>90% purity)

Comparative Analysis with Related Transporters

MTP11’s specificity and localization distinguish it from other CDFs.

TransporterLocalizationPrimary MetalMechanism
MTP11Golgi/pre-vacuolarMnVesicular exocytosis
VIT1TonoplastFe, MnVacuolar sequestration
OsMTP9Plasma membrane (roots)MnEfflux to root stele

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTP11; At2g39450; F12L6.11; Metal tolerance protein 11; AtMTP11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTP11
Target Protein Sequence
MVEPASPDSDEGISLLEFHGNGDRSWQLNFDDFQVSPEHKEKKSPSKLHNCLGCLGPEDN VADYYQQQVEMLEGFTEMDELAERGFVPGMSKEEQDNLAKSETLAIRISNIANMLLFAAK VYASVTSGSLAIIASTLDSLLDLLSGFILWFTAFSMQTPNPYQYPIGKKRMQPLGILVFA SVMATLGLQIILESLRTMLSSHKEFNLTKEQESWVVGIMLSVTLVKLLLVLYCRSFTNEI VKAYAQDHFFDVITNIIGLIAVILANYIDYWIDPVGAIILALYTIRTWSMTVLENVNSLV GKSARPEYLQKLTYLCWNHHKAIRHIDTVRAYTFGSHYFVEVDIVLPADMPLQVAHDIGE SLQEKLELLEEIERAFVHLDYEYTHKPEHARSHC
Uniprot No.

Target Background

Function
Cation/proton antiporter involved in endogenous manganese tolerance, likely through vesicular trafficking and exocytosis.
Gene References Into Functions
  1. Expression of the Arabidopsis and poplar MTP11 cation diffusion facilitators in a manganese-hypersensitive yeast mutant restores manganese tolerance to wild-type levels. [MTP11] PMID: 17494768
  2. The role of MTP11 in manganese transport and tolerance in A. thaliana and in transgenic S. cerevisiae is reported. [AtMTP11] PMID: 17559518
Database Links

KEGG: ath:AT2G39450

STRING: 3702.AT2G39450.1

UniGene: At.21333

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Prevacuolar compartment membrane. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is AtMTP11 and what is its primary function in Arabidopsis thaliana?

AtMTP11 is a member of the Cation Diffusion Facilitator (CDF) family of metal transporters in Arabidopsis thaliana. Its primary function involves the transport and sequestration of manganese (Mn) ions, contributing to cellular metal homeostasis. Unlike AtMTP3, which primarily mediates zinc exclusion from shoots under iron deficiency and zinc oversupply conditions , AtMTP11 is specialized for manganese transport. The protein functions at the pre-vacuolar compartment and is crucial for manganese detoxification through the secretory pathway, helping plants maintain appropriate cellular manganese levels when exposed to excess manganese conditions.

How does AtMTP11 differ from other metal tolerance proteins in Arabidopsis?

While many MTPs in Arabidopsis thaliana share structural similarities as members of the CDF family, they differ in metal specificity, subcellular localization, and expression patterns. For instance, AtMTP3 localizes to the vacuolar membrane and is primarily involved in zinc and cobalt tolerance . When expressed in yeast mutants, AtMTP3 restores tolerance to zinc and cobalt, and its expression is induced under high zinc or cobalt conditions, or under iron deficiency . In contrast, AtMTP11 localizes to pre-vacuolar compartments and Golgi apparatus, specifically handling manganese transport. This differentiation in metal specificity and subcellular targeting allows Arabidopsis to maintain precise control over various metal ions through a coordinated network of transporters.

What factors regulate AtMTP11 gene expression?

AtMTP11 expression is regulated by several factors, primarily manganese availability. Unlike AtMTP3, which is strongly induced by zinc or cobalt exposure and iron deficiency specifically in epidermal and cortex cells of the root hair zone , AtMTP11 expression responds to manganese status. The regulatory mechanisms likely involve metal-responsive transcription factors, although these are not as well characterized as for other metal transporters. The expression pattern of AtMTP11 differs from AtMTP3, which shows strong induction in specific root tissues under metal stress conditions , highlighting the specialized roles these transporters play in metal homeostasis networks.

How does AtMTP11 expression compare across different tissues and developmental stages?

AtMTP11 shows differential expression across plant tissues, with highest expression typically observed in vegetative tissues like leaves where manganese detoxification is particularly important. This expression pattern contrasts with that of AtMTP3, which shows strong induction specifically in epidermal and cortex cells of the root hair zone when plants are exposed to high zinc or cobalt concentrations . The tissue-specific expression of these metal transporters reflects their specialized functions in metal homeostasis throughout the plant. Developmental regulation of AtMTP11 occurs in response to changing metal requirements during plant growth and environmental conditions.

What are the recommended protocols for expressing recombinant AtMTP11 in heterologous systems?

For recombinant expression of AtMTP11, researchers should consider the following methodological approach:

  • Vector Selection: Choose expression vectors with strong promoters (e.g., 35S for plant expression, GAL1 for yeast). For bacterial expression, pET series vectors with T7 promoters are recommended.

  • Expression Systems:

    • E. coli: BL21(DE3) strain optimized for membrane protein expression with induction at lower temperatures (16-20°C) to enhance proper folding.

    • S. cerevisiae: Mutant strains deficient in manganese transport (e.g., pmr1Δ) for complementation studies.

    • A. thaliana: Transgenic approaches using floral dip method with AtMTP11 knockout mutants as background.

  • Protein Purification Strategy: Use affinity tags (His6 or Strep) at the C-terminus to minimize interference with membrane insertion. Solubilize with mild detergents like DDM (n-dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) at 4°C.

This approach differs somewhat from heterologous expression of AtMTP3, which has been successfully expressed in yeast mutants deficient in zinc transport (zrc1 cot1) to demonstrate its role in zinc and cobalt tolerance .

What techniques are most effective for analyzing AtMTP11 transport activity?

Several complementary approaches provide robust assessment of AtMTP11 transport activity:

  • Yeast Complementation Assays: Transform AtMTP11 into manganese-sensitive yeast strains (e.g., pmr1Δ) and assess growth restoration on manganese-supplemented media. This approach has been successfully used with AtMTP3 in zinc-sensitive yeast mutants to demonstrate its role in zinc and cobalt tolerance .

  • Radioisotope Uptake Studies: Use 54Mn to quantify transport kinetics in membrane vesicles prepared from expression systems. Measure time-dependent accumulation with the following parameters:

    • Km typically in the μM range for manganese

    • Vmax values normalized to protein content

    • Transport inhibited by carbonyl cyanide m-chlorophenyl hydrazone (CCCP)

  • Fluorescent Metal Sensors: Deploy manganese-specific fluorescent probes in transformed cells to visualize real-time transport activity.

  • Electrophysiological Methods: For advanced characterization, patch-clamp analysis of AtMTP11-expressing oocytes or giant protoplasts can provide direct measurement of transport currents.

These methods can be adapted from approaches used to study other metal transporters like AtMTP3, where overexpression studies in Arabidopsis have demonstrated increased zinc accumulation in both roots and rosette leaves, enhancing zinc tolerance .

What structural features enable AtMTP11's manganese transport specificity?

AtMTP11's manganese specificity derives from several structural elements:

  • Metal Binding Sites: The protein contains distinct manganese coordination sites formed by conserved histidine and aspartate residues in transmembrane domains 2, 5, and 6. These sites have geometries optimized for manganese coordination, unlike AtMTP3's binding sites which are specialized for zinc and cobalt .

  • Transmembrane Domain Organization: Six predicted transmembrane domains form a transport pore with manganese-specific dimensions.

  • Signature CDF Motifs: Contains modified versions of the CDF signature sequences that favor manganese over zinc, unlike AtMTP3 which contains signature sequences optimized for zinc binding .

Understanding these structural differences is crucial for researchers seeking to manipulate metal specificity through protein engineering approaches.

How does AtMTP11 contribute to manganese tolerance compared to AtMTP3's role in zinc homeostasis?

AtMTP11 and AtMTP3 employ distinct mechanisms for metal detoxification:

FeatureAtMTP11 (Mn handling)AtMTP3 (Zn handling)
Detoxification mechanismSequestration in pre-vacuolar compartments and GolgiVacuolar sequestration of excess Zn
Expression responseUpregulated under Mn excessInduced by high Zn/Co or Fe deficiency
Tissue specificityBroad expression patternSpecific induction in root epidermal and cortex cells
Loss-of-function phenotypeManganese hypersensitivityZinc hypersensitivity and enhanced Zn accumulation in shoots
Gain-of-function outcomeEnhanced Mn toleranceIncreased Zn accumulation in roots and rosette leaves with enhanced Zn tolerance

AtMTP3 contributes to basic cellular zinc tolerance and controls zinc partitioning, particularly under conditions where high rates of zinc influx occur into the root symplasm . In contrast, AtMTP11 manages manganese homeostasis through compartmentalization in the secretory pathway.

What are the consequences of AtMTP11 silencing or knockout on plant stress responses?

When AtMTP11 is silenced or knocked out, several physiological changes occur:

  • Manganese Hypersensitivity: Plants show reduced growth and chlorosis when exposed to elevated manganese levels, similar to how AtMTP3 silencing causes zinc hypersensitivity .

  • Altered Photosynthetic Performance: Decreased photosystem II efficiency occurs due to improper manganese distribution to chloroplasts.

  • Enhanced Oxidative Stress: Increased reactive oxygen species production results from free manganese catalyzing Fenton-like reactions.

  • Altered Distribution of Manganese: Similar to how AtMTP3 silencing enhances zinc accumulation in above-ground organs of soil-grown plants , AtMTP11 silencing affects manganese partitioning between roots and shoots.

These effects differ from the impact of silencing AtMTP3, which primarily affects zinc homeostasis and causes zinc hypersensitivity and enhanced zinc accumulation in above-ground organs under zinc excess or iron deficiency conditions .

How can CRISPR-Cas9 genome editing be optimized for studying AtMTP11 function?

For optimal CRISPR-Cas9 editing of AtMTP11:

  • sgRNA Design Considerations:

    • Target early exons to ensure complete loss of function

    • Select target sites with minimal off-target potential

    • Recommended PAM sites occur at positions 312-314 and 587-589 of the coding sequence

  • Delivery Method:

    • Agrobacterium-mediated transformation with floral dip method

    • Use of egg cell-specific promoters (EC1.2) for Cas9 expression enhances germline editing efficiency

  • Mutation Screening Strategy:

    • High-resolution melt analysis for initial screening

    • Sanger sequencing for mutation confirmation

    • Phenotypic validation under manganese stress conditions

  • Validation Approaches:

    • Complementation with native AtMTP11 promoter driving wild-type coding sequence

    • Metal content analysis using ICP-MS to assess manganese distribution

    • Transport assays in isolated membrane vesicles

Similar genome editing approaches could be applied to study other metal transporters like AtMTP3, which has been successfully silenced through RNA interference to demonstrate its role in zinc homeostasis .

What are the most significant challenges when studying metal transport activity of recombinant AtMTP11?

Researchers face several challenges when characterizing AtMTP11 transport:

  • Protein Instability: Membrane proteins like AtMTP11 often denature during extraction and purification. Recommendation: Use stabilizing agents like glycerol (10-15%) and mild detergents (DDM at 1-2x CMC).

  • Low Expression Yields: Metal transporters typically express poorly in heterologous systems. Strategy: Optimize codon usage for expression system and consider fusion partners (GFP or MBP) that enhance folding.

  • Transport Assay Limitations: Direct measurement of manganese flux is technically challenging. Approach: Combine multiple methods (complementation, radioisotope uptake, ICP-MS) for comprehensive analysis.

  • Distinguishing Secondary Effects: Changes in manganese distribution may result from indirect physiological responses. Solution: Generate transport-defective mutants through directed mutagenesis of key residues for control comparisons.

  • Redundancy with Other Transporters: Functional overlap can mask phenotypes in single knockout lines. Recommendation: Generate higher-order mutants with related manganese transporters.

Similar challenges are encountered when studying other metal transporters like AtMTP3, which shares functional redundancy with other zinc transporters in Arabidopsis .

How does current AtMTP11 research contribute to understanding plant adaptation to metal-contaminated soils?

AtMTP11 research provides several insights into plant adaptation mechanisms:

  • Metal-Specific Adaptation Pathways: Studies reveal how plants have evolved distinct mechanisms for different metals, with AtMTP11 specialized for manganese and others like AtMTP3 specialized for zinc .

  • Transporter Network Coordination: Research demonstrates how multiple transporters work in concert to maintain metal homeostasis, with different proteins handling specific metals and cellular compartments.

  • Breeding Applications: Understanding the molecular basis of metal tolerance through proteins like AtMTP11 and AtMTP3 enables targeted breeding approaches for phytoremediation or crop cultivation on contaminated soils.

  • Evolutionary Insights: Comparative studies of MTP proteins across plant species reveal evolutionary adaptation to different soil conditions, similar to how AtMTP3 contributes to zinc partitioning under conditions of high zinc influx .

This research complements studies of other metal tolerance proteins like AtMTP3, which has been shown to be strongly induced under high zinc or cobalt concentrations, or under iron deficiency, specifically in epidermal and cortex cells of the root hair zone .

What bioinformatic tools are most valuable for identifying potential AtMTP11 interacting partners?

Several bioinformatic approaches aid identification of AtMTP11 interaction networks:

  • Co-expression Analysis:

    • Tools: ATTED-II, PlaNet, CoNekT

    • Focus on genes with Pearson correlation coefficients >0.8 across multiple stress conditions

    • Similar analyses could identify genes co-expressed with AtMTP3 under zinc stress or iron deficiency conditions

  • Protein-Protein Interaction Prediction:

    • Tools: STRING, Arabidopsis Interactions Viewer, PRIN

    • Look for high confidence scores (>0.7) with other transporters and metal homeostasis proteins

  • Subcellular Co-localization Databases:

    • SUBA4 for identifying other Golgi/PVC-localized proteins

    • Focus on membrane trafficking components that might regulate AtMTP11 localization

  • Promoter Analysis:

    • MEME-suite for identifying shared regulatory motifs with other metal-responsive genes

    • Particularly useful for identifying manganese-responsive elements

  • Phylogenetic Profiling:

    • Identify proteins with similar evolutionary patterns across species

    • OrthoMCL and GreenPhylDB are particularly useful for plant comparative genomics

These approaches could be compared to analyses of other metal transporters like AtMTP3, which has been shown to be specifically expressed in epidermal and cortex cells of the root hair zone under metal stress conditions .

What are promising strategies for exploring the coordination between AtMTP11 and other metal transporters?

Future research should focus on these approaches:

  • Multi-omics Integration: Combine transcriptomics, proteomics, and metabolomics data to identify coordinated responses between AtMTP11 and other transporters under varying metal conditions.

  • Advanced Imaging Techniques:

    • FRET-based approaches to visualize direct protein-protein interactions

    • Live-cell imaging with metal-specific fluorescent sensors to track dynamic metal fluxes

  • Multi-transporter Mutants: Generate higher-order mutants combining AtMTP11 with other manganese transporters and related proteins like AtMTP3 to untangle overlapping functions.

  • Structural Biology Approaches: Resolve the three-dimensional structure of AtMTP11 to understand the molecular basis of transport, following approaches similar to those used for other membrane transporters.

  • Systems Biology Modeling: Develop mathematical models of cellular metal homeostasis incorporating multiple transporters and their regulatory networks.

These approaches would complement studies of other metal transporters like AtMTP3, which has been shown to work in concert with other zinc transporters to maintain zinc homeostasis in Arabidopsis .

How might emerging genome editing technologies enhance our understanding of AtMTP11 function?

Emerging technologies offer new avenues for AtMTP11 research:

  • Base Editing: Enables precise single nucleotide changes without double-strand breaks, allowing:

    • Systematic mutation of metal-binding residues

    • Modification of regulatory sequences to alter expression patterns

    • Introduction of fluorescent tags at endogenous loci

  • Prime Editing: Offers versatility for introducing specific mutations or small insertions without donor templates, facilitating:

    • Domain swapping between different MTP proteins

    • Creation of reporter lines with minimal disruption

    • Introduction of protein variants to test structure-function hypotheses

  • CRISPR Activation/Interference (CRISPRa/CRISPRi):

    • Modulate AtMTP11 expression without altering sequence

    • Study dosage effects on manganese homeostasis

    • Investigate tissue-specific functions through targeted expression changes

  • Multiplexed Editing: Simultaneously modify AtMTP11 and other transporters to study:

    • Genetic interactions

    • Compensatory mechanisms

    • Hierarchical importance in manganese homeostasis networks

Similar approaches could enhance our understanding of other metal transporters like AtMTP3, which has been shown to play a key role in zinc homeostasis in Arabidopsis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.