Recombinant Arabidopsis thaliana Metal tolerance protein 9 (MTP9)

Shipped with Ice Packs
In Stock

Description

Introduction to Metal Tolerance Proteins in Plants

Metal tolerance proteins (MTPs) belong to the cation diffusion facilitator (CDF) family and function as important proton/divalent cation transporters in plants. These proteins are responsible for the efflux of cations from the cytoplasm to the extracellular space or the transport of cations from the cytoplasm to subcellular organelles, making them essential for metal tolerance . In Arabidopsis thaliana, a well-established model organism for plant research, the MTP family comprises 12 members that have been functionally characterized to transport various divalent metal ions, including Zn²⁺, Mn²⁺, Co²⁺, and Ni²⁺ .

The CDF family members in plants are categorized into three distinct classes based on substrate specificity: Mn-CDFs, Fe/Zn-CDFs, and Zn-CDFs. These classes are further divided into seven groups based on phylogenetic relationships and annotations in Arabidopsis thaliana: groups 1, 5, and 12 are Zn-CDFs; groups 6 and 7 are Fe/Zn-CDFs; and groups 8 and 9 are the Mn-CDFs . This classification provides important insights into the potential substrate specificity and functional roles of individual MTP proteins.

MTP9 in the Context of MTP Family Functions

Based on its classification within group 9 of the Mn-CDF subfamily, MTP9 is likely involved in manganese transport and tolerance mechanisms . While the available search results do not provide direct experimental evidence specific to MTP9's function, insights can be drawn from research on related MTP proteins within the same subfamily.

For instance, MTP8, another member of the Mn-CDF family, has been extensively studied and contributes to manganese detoxification in both Arabidopsis thaliana and Oryza sativa . Similarly, AtMTP11, which belongs to the same phylogenetic cluster as MTP9, has been demonstrated to confer manganese tolerance when expressed in Saccharomyces cerevisiae and transports Mn²⁺ via a proton-antiport mechanism .

Potential Mechanisms of Action

As a member of the CDF family, MTP9 likely functions as a proton-coupled antiporter that uses the energy from proton gradients to facilitate the transport of divalent metal ions across biological membranes. This mechanism enables plants to sequester excess metals in subcellular compartments or expel them from the cell, thereby preventing toxic accumulation in the cytoplasm.

The research on AtMTP11 provides valuable insights into how MTP9 might function. When AtMTP11 was expressed in yeast, it conferred Mn²⁺ tolerance specifically, without affecting tolerance to other metals like Cu²⁺ or Zn²⁺ . This suggests that MTP9, as a related protein in the same subfamily, might also exhibit metal-specific transport activity, possibly focusing on manganese.

Subcellular Localization and Physiological Significance

The subcellular localization of MTP proteins is crucial to their function in metal homeostasis. Different MTPs are targeted to various cellular compartments, including the plasma membrane, vacuole, and Golgi apparatus, which determines their specific roles in metal transport pathways.

Studies on AtMTP11 have shown that it localizes to pre-vacuolar compartments and is implicated in both manganese tolerance and manganese homeostasis mechanisms in Arabidopsis . Given its phylogenetic relationship with MTP11, MTP9 might similarly be involved in intracellular trafficking of manganese, potentially contributing to both normal homeostasis under sufficient conditions and detoxification under excess metal exposure.

MTP9 versus MTP10

While MTP9 is likely involved in manganese transport based on its classification, MTP10, another member of the MTP family in Arabidopsis, has been characterized as an important regulator for maintaining homeostasis of magnesium and calcium . Unlike MTP9, MTP10 appears to have a broader role in divalent cation homeostasis. Research has shown that the mtp10 mutant displayed severe growth retardation in the presence of excess Mg²⁺, which could be rescued by the addition of Ca²⁺ . This highlights the functional diversity within the MTP family, suggesting that different members have evolved specialized roles in managing distinct metal ions.

MTP Family in Different Plant Species

The MTP family has been identified and characterized in various plant species beyond Arabidopsis. In barley, for example, comprehensive analysis of the HvMTP gene family revealed their involvement in nutrient homeostasis throughout the plant's life cycle . Expression of barley HvMTP genes was induced by at least one metal ion among Zn²⁺, Cu²⁺, As³⁺, and Cd²⁺, suggesting their role in metal tolerance or transportation . This comparative perspective provides valuable insights into the potential functions and evolutionary significance of MTP9 in the broader context of plant metal homeostasis.

Biochemical and Functional Characterization

Recombinant Arabidopsis thaliana MTP9 protein serves as a valuable tool for investigating the biochemical properties and functional characteristics of this metal transporter. Researchers can use the purified protein for:

  • In vitro transport assays to determine metal specificity and kinetics

  • Structural studies to elucidate the three-dimensional organization of the protein

  • Interaction studies to identify potential binding partners or regulators

Biotechnological Applications

Understanding the function of MTP9 could lead to various biotechnological applications, including:

  • Development of plants with enhanced metal tolerance for phytoremediation

  • Biofortification strategies to optimize micronutrient content in crops

  • Engineering of plants with improved growth in metal-contaminated soils

Reconstitution Protocol

The lyophilized protein should be briefly centrifuged prior to opening to bring the contents to the bottom of the vial. It should then be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol to a final concentration of 5-50%, with 50% being the default recommendation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
MTP9; At1g79520; T8K14.6; Metal tolerance protein 9; AtMTP9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-402
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTP9
Target Protein Sequence
MAATEHRGLSGGDYNVDLLPIDQDDSPPSSWRLSLDTFRLPSSSPLSSGRHNGRTRLSRY LRTPKKERKVSEYYKQQEKLLEGFNEMETINETGFVSGAPTEEELKKLAKSERLAVHISN AANLVLFVAKVYASVESRSMAVIASTLDSLLDLLSGFILWFTANAMRTPNNFRYPIGKRR MQPVGIIVFASVMATLGLQVILESTRLLVSKNGSHMSSTEEKWMIGIMASATVVKFLLML YCRSFQNEIVRAYAQDHLFDVITNSVGLATAVLAVKFYWWIDPSGAILIALYTISTWART VLENVHSLIGRSAPPDFLAKLTFLIWNHHEKIKHIDTVRAYTFGSHYFVEVDIVLPEDMR LHEAHNIGETLQEKLEQLSEVERAFVHIDFEFTHRPEHKCKV
Uniprot No.

Target Background

Function
MTP9 plays a critical role in sequestering excess metal within the cytoplasm into vacuoles, contributing to the maintenance of metal homeostasis within the cell.
Database Links

KEGG: ath:AT1G79520

STRING: 3702.AT1G79520.2

UniGene: At.43219

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is Metal tolerance protein 9 (MTP9) and what is its significance in Arabidopsis thaliana?

Metal tolerance protein 9 (MTP9) belongs to the cation diffusion facilitator (CDF) family of metal transporters in Arabidopsis thaliana. The protein plays a crucial role in metal homeostasis, particularly in the transport and sequestration of divalent metal ions. Based on structural analysis, MTP9 contains 402 amino acids and features transmembrane domains characteristic of metal transporters . The protein is encoded by the MTP9 gene, which is located at the At1g79520 locus on chromosome 1 (also known as T8K14.6) . Understanding MTP9's function contributes to our broader knowledge of how plants regulate metal homeostasis, which is essential for both normal development and tolerance to metal stress.

How is recombinant MTP9 typically produced for research applications?

Recombinant Arabidopsis thaliana MTP9 is typically expressed in prokaryotic systems, with E. coli being the predominant expression host . The full-length protein (comprising amino acids 1-402) is often expressed with an N-terminal His-tag to facilitate purification via affinity chromatography . The recombinant protein production process generally involves:

  • Cloning the MTP9 coding sequence into an appropriate expression vector

  • Transforming the expression construct into E. coli

  • Inducing protein expression under optimized conditions

  • Lysing bacterial cells and purifying the protein via His-tag affinity chromatography

  • Confirming protein purity (>90%) using SDS-PAGE analysis

  • Lyophilizing the purified protein for long-term storage and stability

This approach yields recombinant MTP9 that can be used for various research applications, including structural studies, functional assays, and protein-protein interaction analyses.

What are the optimal storage conditions for recombinant MTP9?

Recombinant MTP9 protein requires specific storage conditions to maintain stability and activity. The recommended storage conditions include:

  • Long-term storage: -20°C to -80°C in aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

For lyophilized recombinant MTP9 protein, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) before aliquoting for long-term storage . Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity and activity .

What experimental approaches are recommended for studying MTP9 metal transport activity in vitro?

For studying the metal transport activity of recombinant MTP9 in vitro, several methodological approaches can be employed:

  • Vesicle Transport Assays: Reconstituting purified MTP9 into artificial liposomes loaded with fluorescent metal indicators to measure metal transport kinetics across membranes.

  • Metal Binding Assays: Utilizing isothermal titration calorimetry (ITC) or microscale thermophoresis (MST) to determine the binding affinities of different metal ions to recombinant MTP9.

  • Structural Analysis: Applying X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of MTP9, particularly focusing on metal binding sites within the protein structure.

When designing these experiments, researchers should consider the full-length amino acid sequence of MTP9 (402 amino acids) , which contains multiple predicted transmembrane domains and metal-binding motifs. The presence of the His-tag should be evaluated for potential interference with metal binding studies, and control experiments with tag-cleaved protein may be necessary.

How can researchers optimize heterologous expression and purification of functional MTP9?

Optimizing heterologous expression and purification of functional MTP9 presents several challenges due to its transmembrane nature. The following methodological considerations are recommended:

  • Expression System Selection: While E. coli is commonly used , eukaryotic expression systems like yeast, insect cells, or plant cell cultures may better preserve protein folding and post-translational modifications.

  • Solubilization Strategy:

    • Use mild detergents (DDM, LMNG, or Fos-choline derivatives) for membrane protein extraction

    • Optimize detergent concentration to maximize protein yield while maintaining native structure

    • Consider nanodiscs or amphipols for stabilizing the protein in a membrane-like environment

  • Purification Protocol:

    • Implement two-step purification using affinity chromatography (via His-tag) followed by size exclusion chromatography

    • Maintain optimal buffer conditions (pH 8.0 with 6% trehalose has been reported to stabilize MTP9)

    • Monitor protein quality throughout purification using dynamic light scattering and thermal shift assays

  • Functional Verification:

    • Assess protein integrity by circular dichroism spectroscopy

    • Verify metal binding capability through metal-specific fluorescent probes or isothermal titration calorimetry

Through careful optimization of these parameters, researchers can improve the yield and quality of functional recombinant MTP9 for downstream applications.

What genetic engineering approaches can be used to study MTP9 function in planta?

Arabidopsis thaliana's extensive genetic toolbox makes it an ideal system for studying MTP9 function through various genetic engineering approaches:

  • CRISPR/Cas9 Gene Editing: This technique allows precise modification of the MTP9 gene (At1g79520) to create knockout mutants or introduce specific mutations . This approach can be used to:

    • Generate complete loss-of-function alleles

    • Create specific amino acid substitutions to study structure-function relationships

    • Modify regulatory elements to alter expression patterns

  • Complementation Studies: In MTP9 mutant backgrounds, researchers can transform plants with:

    • Wild-type MTP9 constructs to confirm phenotypic rescue

    • Domain-swapped versions to identify functional regions

    • Site-directed mutants to assess the importance of specific residues

  • Reporter Fusions: Creating MTP9-reporter gene fusions can reveal:

    • Subcellular localization using fluorescent protein tags

    • Expression patterns using promoter-reporter constructs

    • Protein-protein interactions using split-reporter systems

  • Overexpression Studies: Constitutive or inducible overexpression of MTP9 can help determine:

    • Effects of increased dosage on metal homeostasis

    • Potential gain-of-function phenotypes

    • Tissue-specific functions using tissue-specific promoters

Transformation can be performed using the facile Agrobacterium-mediated floral dip method, which is well-established for Arabidopsis thaliana . The rapid life cycle of Arabidopsis (approximately 6 weeks from seed to mature seed) enables efficient generation of transgenic lines for these studies .

How can protein-protein interaction studies be designed to identify MTP9 binding partners?

To elucidate the protein interaction network of MTP9, several complementary approaches can be employed:

  • Yeast Two-Hybrid (Y2H) Screening:

    • For membrane proteins like MTP9, modified Y2H systems such as split-ubiquitin Y2H may be more appropriate

    • Arabidopsis-specific Y2H vectors are available from community resources

    • Screen against normalized Arabidopsis cDNA libraries to identify potential interactors

  • Co-Immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged recombinant MTP9

    • Employ crosslinking agents to stabilize transient interactions

    • Analyze co-precipitated proteins by mass spectrometry

    • Validate interactions with targeted Western blotting

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse candidate interacting proteins with complementary fragments of fluorescent proteins

    • Express in Arabidopsis protoplasts or stable transgenic lines

    • Analyze reconstituted fluorescence by confocal microscopy to confirm interactions and determine subcellular localization

  • Proximity-Dependent Biotin Identification (BioID):

    • Fuse MTP9 to a promiscuous biotin ligase

    • Express in Arabidopsis to biotinylate proximal proteins

    • Purify biotinylated proteins for mass spectrometry analysis

When analyzing potential interactions, researchers should consider the transmembrane topology of MTP9 and design constructs that preserve the proper membrane orientation of interaction domains.

What approaches are effective for studying the metal specificity and transport kinetics of MTP9?

Understanding the metal specificity and transport kinetics of MTP9 requires sophisticated experimental approaches:

  • Metal Sensitivity Assays in Heterologous Systems:

    • Express MTP9 in metal-sensitive yeast mutants defective in metal transport

    • Assess growth restoration under varying metal concentrations

    • Compare wild-type and mutant versions of MTP9 to identify residues critical for specificity

  • Radioactive Metal Uptake/Efflux Assays:

    • Use radioisotopes of relevant metals (e.g., 65Zn, 55Fe, 63Ni, 109Cd) to trace transport

    • Measure time-dependent accumulation or efflux in cells expressing MTP9

    • Determine Km and Vmax values for different metal substrates

  • Electrophysiological Measurements:

    • Incorporate purified MTP9 into artificial bilayers

    • Measure ion currents using patch-clamp techniques

    • Characterize channel/transporter properties under varying conditions

  • Fluorescent Metal Probes:

    • Use metal-specific fluorescent sensors in live cells expressing MTP9

    • Monitor real-time changes in metal concentrations using confocal microscopy

    • Correlate with MTP9 expression and localization

These approaches should be combined with structural analysis of the MTP9 amino acid sequence to identify potential metal-coordinating residues that can be targeted for mutagenesis studies.

How can researchers analyze the structure-function relationship of MTP9 domains?

Understanding the structure-function relationship of MTP9 domains requires a multi-faceted approach:

  • Computational Structure Prediction:

    • Analyze the full 402-amino acid sequence using protein structure prediction tools

    • Identify conserved domains through multiple sequence alignment with other Metal tolerance proteins

    • Predict transmembrane regions and potential metal-binding sites

  • Domain Deletion and Mutation Analysis:

    • Generate recombinant proteins with systematic deletions or mutations of predicted functional domains

    • Express these variants in appropriate systems and assess metal transport capability

    • Compare activity to wild-type recombinant MTP9

  • Chimeric Protein Analysis:

    • Create fusion proteins swapping domains between MTP9 and related transporters

    • Assess metal specificity and transport efficiency

    • Identify domains responsible for specific functional properties

  • Structural Biology Approaches:

    • Attempt crystallization of purified recombinant MTP9 for X-ray diffraction studies

    • Consider cryo-electron microscopy for membrane protein structure determination

    • Employ nuclear magnetic resonance (NMR) for studying specific domains

What experimental designs are recommended for investigating MTP9 regulation in response to metal stress?

To investigate how MTP9 is regulated in response to metal stress, researchers can implement the following experimental designs:

  • Transcriptional Regulation Studies:

    • Generate transgenic Arabidopsis lines with MTP9 promoter-reporter fusions

    • Expose plants to various metal stresses and measure reporter activity

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the MTP9 promoter

    • Use Arabidopsis's advanced intercross recombinant inbred lines (AI-RILs) for QTL mapping of regulatory elements

  • Post-Transcriptional Regulation Analysis:

    • Measure MTP9 mRNA stability under different metal stress conditions

    • Investigate potential microRNA regulation of MTP9 expression

    • Analyze alternative splicing patterns of MTP9 transcripts

  • Post-Translational Modification Studies:

    • Identify potential phosphorylation, ubiquitination, or other modification sites

    • Generate antibodies against modified forms of MTP9

    • Use mass spectrometry to map modifications in response to metal stress

    • Create non-modifiable mutant versions for functional testing

  • Protein Stability and Trafficking Analysis:

    • Investigate MTP9 protein half-life under different metal conditions

    • Track subcellular localization changes using fluorescent protein fusions

    • Determine if metal availability affects MTP9 membrane insertion or recycling

The rapid life cycle and genetic tractability of Arabidopsis thaliana make it an excellent system for these regulatory studies, allowing researchers to complete complex experiments in relatively short timeframes .

What are common challenges in working with recombinant MTP9 and how can they be addressed?

Researchers working with recombinant MTP9 often encounter several challenges that can be addressed through methodological refinements:

  • Limited Protein Solubility:

    • Challenge: As a membrane protein, MTP9 has hydrophobic regions that can cause aggregation.

    • Solution: Optimize detergent selection and concentration during purification; consider using specialized membrane protein expression systems; explore fusion partners that enhance solubility.

  • Reduced Functional Activity After Purification:

    • Challenge: Loss of native lipid environment can compromise MTP9 function.

    • Solution: Reconstitute purified protein in liposomes composed of plant membrane-mimicking lipids; consider nanodiscs or amphipols for maintaining a membrane-like environment.

  • Protein Degradation:

    • Challenge: Recombinant MTP9 may be susceptible to proteolytic degradation.

    • Solution: Include protease inhibitors throughout purification; optimize buffer conditions (pH 8.0 has been reported as optimal) ; minimize handling time and maintain low temperatures during purification.

  • Low Expression Yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems.

    • Solution: Test different expression hosts beyond E. coli ; optimize codon usage for the expression system; consider inducible promoters with tunable expression levels; explore fusion partners that enhance expression.

  • Protein Misfolding:

    • Challenge: Improper folding can result in non-functional protein.

    • Solution: Include molecular chaperones during expression; lower expression temperature; explore different cell compartments for targeting; consider refolding protocols if necessary.

Careful optimization of these parameters can significantly improve the quality and yield of functional recombinant MTP9 for research applications.

How can researchers verify the functional integrity of purified recombinant MTP9?

Verifying the functional integrity of purified recombinant MTP9 is crucial for ensuring reliable experimental results. Several complementary approaches are recommended:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure elements

    • Size exclusion chromatography to verify proper oligomeric state

    • Dynamic light scattering to check for aggregation

    • Thermal shift assays to assess protein stability

  • Metal Binding Verification:

    • Isothermal titration calorimetry (ITC) to measure binding affinities for various metals

    • Fluorescence-based metal binding assays using metal-sensitive fluorophores

    • Intrinsic tryptophan fluorescence quenching upon metal binding

  • Functional Transport Assays:

    • Liposome-based transport assays using fluorescent metal indicators

    • Metal uptake/efflux studies in reconstituted systems

    • Patch-clamp electrophysiology for direct measurement of transport activity

  • Interaction Partner Binding:

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to verify binding to known interaction partners

    • Pull-down assays to confirm retention of interaction capabilities

The full-length recombinant MTP9 (402 amino acids) should be tested under conditions that mimic its native environment, including appropriate pH, ionic strength, and lipid composition, to obtain the most relevant functional data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.