Recombinant Arabidopsis thaliana Metal tolerance protein A2 (MTPA2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Metal Homeostasis

MTPA2 plays a central role in divalent cation transport and detoxification:

  • Substrate Specificity:

    • Primarily transports Zn²⁺ and Co²⁺, conferring tolerance to excess metals .

    • Indirectly modulates Fe²⁺ homeostasis under iron-deficient conditions .

  • Regulation:

    • Expression is induced by iron deficiency via the transcription factor FIT (FER-LIKE IRON DEFICIENCY-INDUCED TRANSCRIPTION FACTOR) .

    • Co-regulated with other metal transporters (e.g., IRT1, ZIP8) under metal stress .

Table 1: Metal Substrates and Associated Pathways

Metal IonBiological RoleRegulatory Mechanism
Zn²⁺Detoxification in vacuolesUpregulated under Zn excess
Co²⁺Tolerance to cobalt toxicityCo-induced expression
Fe²⁺Iron deficiency response modulationFIT-dependent induction

Production and Purification

Recombinant MTPA2 is produced in E. coli systems for biochemical studies:

  • Expression System: E. coli with codon optimization for plant genes .

  • Purification: Affinity chromatography via His-tag, yielding >90% purity (SDS-PAGE) .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

Key Studies:

  • Metal Transport Mechanism:

    • MTPA2 localizes to vacuolar membranes, sequestering excess Zn²⁺ and Co²⁺ to mitigate toxicity .

    • Loss-of-function mutants exhibit hypersensitivity to Zn²⁺ and disrupted Fe²⁺ signaling .

  • Gene Structure:

    • The MTPA2 gene lacks introns, a feature conserved across A. thaliana CDF transporters .

  • Biotechnological Potential:

    • Engineered overexpression enhances metal tolerance in transgenic plants, suggesting applications in phytoremediation .

Challenges and Future Directions

  • Structural Insights: No resolved 3D structure exists; computational modeling is ongoing .

  • Functional Redundancy: Overlap with other CDF transporters (e.g., MTP1, MTP4) complicates phenotypic analysis .

  • Agricultural Relevance: Potential for engineering crops with improved metal tolerance using MTPA2 homologs .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTPA2; MTP3; At3g58810; T20N10_160; Metal tolerance protein A2; AtMTP3; AtMTPa2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTPA2
Target Protein Sequence
MVTPKLHLDLSLTKKMKDHIHEHDHMVQICGEVSSGETSLVGIKKTCGEAPCGFSDAKTS SIEAQERAASMRKLLIAVLLCAIFIVVEVVGGIKANSLAILTDAAHLLSDVAAFAISLFS LWASGWKANPQQSYGFFRIEILGALVSIQMIWLLAGILVYEAIVRLNNGSGEVEGSLMFA VSAVGLLVNIAMAILLGHDHGHGHGHSHDNGHGHSHDHGHGIAATEHHHDSGHDESQLSD VLIEQKKQRNVNIQGAYLHVLGDSIQSVGVMIGGAIIWYKPEWKILDLICTLVFSVIVLG TTIGMLRNILEVLMESTPREIDPTMLEKGVCEIEEVVAVHELHIWAITVGKLLLACHVKI RPEAEADMVLDKIIDYIKREHNISHVTIQIERQ
Uniprot No.

Target Background

Function
This protein is involved in the sequestration of excess zinc from the cytoplasm into vacuoles, maintaining zinc homeostasis.
Gene References Into Functions
  1. The MTP3 protein plays a crucial role in basic cellular zinc tolerance and regulates zinc partitioning, particularly under conditions of high zinc influx into the root symplasm. [MTP3] PMID: 16709200
Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MTPA2/AtMTP3 and what is its primary function in Arabidopsis thaliana?

MTPA2, also known as AtMTP3 or Metal Tolerance Protein 3, functions as a metal efflux transporter in Arabidopsis thaliana. It belongs to the Cation Diffusion Facilitator (CDF) family and primarily transports zinc (Zn) from the cytoplasm. AtMTP3 maintains metal homeostasis specifically by mediating Zn exclusion from the shoot under iron (Fe) deficiency and Zn oversupply conditions . The protein plays a crucial role in the plant's metal detoxification system by facilitating the sequestration of potentially toxic metal concentrations .

What metal ions can AtMTP3 transport, and how has this been experimentally verified?

AtMTP3 primarily transports zinc (Zn) and cobalt (Co). This transport capability has been verified through heterologous expression in the zinc-hypersensitive yeast mutant zrc1cot1. When expressed in this system, AtMTP3 conferred tolerance to excessive zinc levels, demonstrating its functional zinc transport activity . Similar experimental approaches have confirmed its ability to transport cobalt as well. Metal-chelate affinity chromatography has been used with related proteins to demonstrate binding of metals including lead (Pb), cadmium (Cd), and copper (Cu) .

Where is AtMTP3 localized within plant cells and how does this relate to its function?

AtMTP3, like some other members of the MTP family, is localized to the vacuolar membrane where it functions in metal detoxification by transporting metals from the cytoplasm into the vacuole . This subcellular localization is strategic as it allows the protein to sequester excess metals away from sensitive cellular components in the large vacuolar compartment. The localization has been determined through techniques including fluorescently-tagged protein expression and microscopy analysis, similar to approaches used for related proteins where autofluorescence-tagged proteins were transiently expressed in tobacco to determine subcellular targeting .

How does AtMTP3 contribute to zinc homeostasis in Arabidopsis?

AtMTP3 maintains zinc homeostasis by mediating zinc exclusion from the shoot, particularly under conditions of iron deficiency and zinc oversupply . This function prevents zinc toxicity in photosynthetically active tissues by restricting its accumulation in shoots. Plants overexpressing AtMTP3 demonstrate enhanced tolerance to cadmium, similar to observations with related metal transport proteins . The protein likely works in concert with other metal transporters to maintain appropriate zinc levels across different plant tissues and cellular compartments, ensuring zinc availability for essential processes while preventing toxic accumulation.

What is the relationship between AtMTP3 and other metal tolerance proteins in the Arabidopsis MTP family?

MTP ProteinPrimary Metal SpecificitySubcellular LocalizationKey Function
AtMTP1ZnVacuolar membraneZn detoxification
AtMTP3Zn, CoVacuolar membraneZn exclusion from shoots
AtMTP8-11MnTrans-Golgi/Pre-vacuolarMn transport and tolerance

What experimental approaches are most effective for studying AtMTP3 function?

Several complementary experimental approaches have proven effective for studying metal tolerance proteins like AtMTP3:

  • Heterologous expression systems: Expression in yeast mutants (e.g., zrc1cot1) allows assessment of metal transport and tolerance .

  • Transgenic plant studies: Overexpression or knockout of AtMTP3 in Arabidopsis demonstrates phenotypic effects under various metal stress conditions .

  • Gene expression analysis: Reverse transcriptase PCR and northern blot analyses reveal expression patterns under different metal stresses .

  • Metal binding assays: Metal-chelate affinity chromatography and fluorescence analysis can demonstrate direct metal binding capabilities .

  • Subcellular localization: Fluorescent protein tagging enables visualization of AtMTP3 localization within cells .

  • Site-directed mutagenesis: Identifying key residues for function through targeted amino acid substitutions .

How is AtMTP3 expression regulated under different metal stress conditions?

AtMTP3 expression appears to be specifically induced under conditions of iron deficiency and zinc oversupply . This regulation allows plants to respond dynamically to changing metal availability in the environment. While the specific transcriptional regulators controlling AtMTP3 expression are not detailed in the provided search results, the response to multiple metal conditions suggests integration with broader metal sensing networks. Similar to other metal transporters, post-transcriptional and post-translational regulation may also play important roles in controlling AtMTP3 activity. Understanding these regulatory mechanisms is crucial for engineering plants with enhanced metal tolerance or accumulation capabilities.

Which specific amino acid residues determine metal binding and transport in AtMTP3?

Based on studies of related MTP proteins, several key amino acid residues likely determine metal binding and transport in AtMTP3. In the related AtMTP1, the active zinc-binding site is formed by His90 and Asp94 in transmembrane domain (TMD) II and His265 and Asp269 in TMD V . These key residues are highly conserved across CDF family proteins. Additionally, residues such as Glu72, Asp87, Glu124, Asn173, and Asp293 in AtMTP1 are important for zinc transport function, potentially involved in translocation of zinc and/or protons through the membrane . Given the 68% sequence identity between AtMTP1 and AtMTP3, homologous residues in AtMTP3 likely play similar roles.

What are the optimal expression systems and purification strategies for recombinant AtMTP3 production?

For recombinant expression of membrane proteins like AtMTP3, several systems can be considered:

  • Bacterial expression (E. coli): Useful for high-yield protein production, though proper folding of membrane proteins can be challenging. Addition of a histidine tag facilitates purification via metal-chelate affinity chromatography .

  • Yeast expression systems: Provide a eukaryotic environment that may better support proper folding and post-translational modifications. The zrc1cot1 yeast mutant has been successfully used to express functional AtMTP3 .

  • Plant-based expression systems: While more complex, these may provide the most native environment for proper folding and function.

Purification typically involves solubilization with appropriate detergents followed by affinity chromatography. For functional studies, reconstitution into proteoliposomes can allow assessment of transport activity in a controlled membrane environment, as has been done with related proteins .

How do post-translational modifications affect AtMTP3 function and localization?

While the search results do not specifically address post-translational modifications of AtMTP3, research on related membrane transporters suggests several possibilities. Phosphorylation often regulates membrane protein activity and trafficking. Metal binding itself can induce conformational changes affecting protein function. The related protein AtFP6 undergoes farnesylation, which affects its membrane association . Such modifications could regulate AtMTP3's transport activity, metal specificity, or subcellular localization in response to changing cellular conditions or metal availability. Methodologies to study these modifications include mass spectrometry (particularly top-down proteomics as mentioned in search result ), phosphoproteomic analysis, and site-directed mutagenesis of potential modification sites.

How does AtMTP3 function differ between metal hyperaccumulator and non-accumulator plant species?

Metal hyperaccumulator plants like Arabidopsis halleri and Noccaea caerulescens show distinct differences in metal partitioning compared to non-hyperaccumulators like Arabidopsis thaliana. In hyperaccumulators, the metal shoot-to-root ratio is generally above unity, whereas in non-hyperaccumulators it remains below unity . While MTP1 has been specifically identified as a key protein for metal sequestration and detoxification in shoots of hyperaccumulators , the exact role of MTP3 in hyperaccumulators requires further investigation. Hyperaccumulators often show constitutive high expression of certain metal transporters, suggesting that differential regulation or expression of AtMTP3 homologs might contribute to the hyperaccumulation phenotype.

What methodological approaches can resolve conflicting data on AtMTP3 metal specificity?

When faced with conflicting data on metal specificity, researchers should consider:

  • Multiple heterologous systems: Testing AtMTP3 function in different expression systems (bacterial, yeast, plant protoplasts) can help distinguish system-specific artifacts from intrinsic protein properties.

  • Direct transport assays: Using radioisotope uptake or fluorescent metal indicators in reconstituted systems provides direct measurement of transport rather than relying on indirect growth assays.

  • Competitive transport assays: Testing transport of one metal in the presence of others can reveal preferences and competition.

  • Structure-function analysis: Comparing metal binding and transport across MTP family members with known differences in specificity can identify determinant residues.

  • In planta validation: Ultimately, confirming metal specificity in transgenic plants under controlled conditions provides the most physiologically relevant data.

How can AtMTP3 be engineered for enhanced heavy metal phytoremediation applications?

Engineering AtMTP3 for phytoremediation applications could follow several strategies:

  • Altered expression patterns: Modifying promoters to increase expression in specific tissues or under specific conditions could enhance metal sequestration capacity.

  • Protein engineering: Targeted mutations based on structure-function knowledge could enhance binding affinity or alter metal specificity. For example, mutations similar to those that altered metal specificity in AtMTP1 (Thr86 and Leu91) could potentially expand AtMTP3's range of detoxifiable metals.

  • Co-expression strategies: Pairing AtMTP3 with other transporters like ACBP2, which binds precursors for phospholipid repair following lipid peroxidation under heavy metal stress , could provide synergistic protection.

  • Subcellular retargeting: Altering localization signals to direct AtMTP3 to different membranes could optimize metal sequestration in different cellular compartments.

Plants overexpressing metal transporters have already demonstrated enhanced tolerance to metals like cadmium , suggesting that similar approaches with AtMTP3 could be effective for phytoremediation applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.