Recombinant Arabidopsis thaliana Metal tolerance protein B (MTPB)

What is Metal Tolerance Protein B (MTPB) in Arabidopsis thaliana?

Metal Tolerance Protein B (MTPB), also known as MTP4 (At2g29410), is a protein from the model plant Arabidopsis thaliana. It belongs to the family of metal tolerance proteins that play crucial roles in metal ion homeostasis and detoxification in plants. MTPB is a full-length protein consisting of 375 amino acids (UniProt ID: Q6DBM8) and likely contributes to metal ion transport and sequestration within plant cells. Based on studies of related proteins like MTP3, MTPB may be involved in zinc or other metal ion homeostasis, potentially functioning at the vacuolar membrane to regulate metal compartmentalization .

How can I obtain recombinant MTPB protein for my research?

Recombinant MTPB can be obtained through heterologous expression systems or commercial sources. For laboratory production, the MTPB gene can be cloned into appropriate expression vectors and expressed in systems such as E. coli with N-terminal His-tags for purification. The recombinant protein can then be purified using affinity chromatography methods. Commercial sources also offer purified recombinant MTPB protein preparations that come as lyophilized powder, which should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage at -20°C/-80°C .

What expression systems are suitable for producing recombinant MTPB?

Several expression systems can be used to produce recombinant MTPB, each with distinct advantages. E. coli is commonly used for its simplicity, rapid growth, and high protein yields. The protein can be expressed with tags like His-tag for purification purposes as demonstrated in available commercial preparations . Alternatively, homologous expression in Arabidopsis itself offers advantages for proper folding and post-translational modifications. Recent developments in Arabidopsis-based super-expression systems have yielded up to 0.4 mg of purified recombinant protein per gram fresh weight, making it a viable platform for producing plant proteins in their native context .

What is the amino acid sequence of Arabidopsis MTPB?

The full amino acid sequence of Arabidopsis thaliana MTPB (1-375aa) is:
MELEQICILKPDDEEEMESPSPSKTEENLGVVPLSCAFTRQEHCVSETKEREESTRRLSSLIFLYLIVMSVQIVGGFKANSLAVMTDAAHLLSDVAGLCVSLLAIKVSSWEANPRNSFGFKRLEVLAAFLSVQLIWLVSGVIIHEAIQRLLSRSREVNGEIMFGISAFGFFMNLVMVLWLGHNHSHHHHDHHHHHHNHKHQHQHHHKEVVAEEEEEEMNPLKGEKSSSKEMNINIQGAYLHAMADMIQSLGVMIGGGIIWVKPKWVLVDLICTLVFSAFALAATLPILKNIFGILMERVPRDMDIEKLERGLKRIDGVKIVYDLHVWEITVGRIVLSCHILPEPGASPKEIITGVRNFCRKSYGIYHATVQVESE

How can I design primers for MTPB cloning and expression?

For effective MTPB cloning and expression, primer design should consider several factors. First, identify the full coding sequence of MTPB (At2g29410) from databases like TAIR or UniProt (Q6DBM8). Design forward and reverse primers with appropriate restriction sites that are compatible with your expression vector but absent in the MTPB sequence. Include 4-6 additional nucleotides upstream of the restriction site to facilitate enzyme binding. For protein expression with tags, ensure the reading frame is maintained. Consider codon optimization if expressing in non-plant systems. Typical primer length should be 25-35 nucleotides with GC content between 40-60% and melting temperatures around 60-75°C. Validate primers using tools like Primer-BLAST to check for specificity and potential secondary structures .

What are the best conditions for storing recombinant MTPB protein?

Optimal storage of recombinant MTPB involves several considerations to maintain protein stability and functionality. After purification, store the protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For long-term storage, it's recommended to add glycerol to a final concentration of 5-50% (with 50% being standard) and aliquot the protein solution to avoid repeated freeze-thaw cycles. Store the aliquots at -20°C or preferably -80°C for extended stability. For working stocks, maintain aliquots at 4°C for up to one week. Before use, centrifuge the vial briefly to bring contents to the bottom. If the protein is supplied as a lyophilized powder, reconstitute it in deionized sterile water to 0.1-1.0 mg/mL before adding glycerol and aliquoting .

How can I confirm the functional activity of recombinant MTPB?

Confirming the functional activity of recombinant MTPB requires multiple approaches. Based on knowledge of related metal tolerance proteins like MTP3, you should assess metal transport capabilities through:

• Complementation assays: Express MTPB in metal-sensitive yeast mutants (such as zrc1 cot1 for zinc sensitivity) and measure growth restoration under metal stress conditions

• Metal uptake/accumulation assays: Quantify metal content in cells/plants expressing recombinant MTPB using ICP-MS (Inductively Coupled Plasma Mass Spectrometry)

• Subcellular localization: Confirm proper localization using MTPB-GFP fusion proteins and fluorescence microscopy, expecting vacuolar membrane localization similar to other MTPs

• Metal tolerance assays: Compare growth of plant lines expressing recombinant MTPB versus controls when exposed to various metal concentrations

The combination of these approaches will provide robust evidence of MTPB functionality and insights into its specific metal substrates and transport mechanisms .

How can I generate MTPB mutants in Arabidopsis using TALEN technology?

Generating MTPB mutants using TALEN (Transcription Activator-Like Effector Nuclease) technology involves a multi-step process. First, design TALEN pairs targeting specific sequences within the MTPB coding region, focusing on conserved or functionally important domains. The TALEN recognition sequences should be 15-20 bp in length with a 14-18 bp spacer between them. Clone the designed TALENs into plant expression vectors with an estrogen-inducible promoter system (such as XVE) to enable controlled expression. Transform Arabidopsis using Agrobacterium-mediated floral dip method and select transformants on media containing hygromycin. Induce TALEN expression using 10-20 μM 17β-estradiol during germination. Screen for mutations using restriction enzyme digestion of PCR products if a restriction site exists in the target region, or T7 endonuclease I (T7EI) assay which detects mismatches in DNA. Confirm mutations by sequencing. Based on similar studies, you can expect somatic mutagenesis frequencies of 2-15% in pooled seedlings, with higher frequencies (up to 41-73%) in individual transgenic lines. Germline mutations can be transmitted to the next generation at frequencies of 1.5-12% .

What approaches can I use to study MTPB protein-protein interactions in planta?

To investigate MTPB protein-protein interactions in planta, multiple complementary techniques should be employed:

• Co-immunoprecipitation (Co-IP): Express MTPB with an affinity tag in Arabidopsis using the super-expression system, extract proteins under mild conditions to maintain interactions, and identify binding partners through immunoprecipitation followed by mass spectrometry

• Bimolecular Fluorescence Complementation (BiFC): Fuse MTPB and candidate interacting proteins to split YFP fragments, co-express in Arabidopsis protoplasts or stable lines, and visualize reconstituted fluorescence indicating interaction

• FRET-FLIM (Förster Resonance Energy Transfer-Fluorescence Lifetime Imaging): Fuse MTPB and potential partners with compatible fluorophores and measure energy transfer indicating close proximity (<10 nm)

• Split-ubiquitin membrane yeast two-hybrid: Particularly useful for membrane proteins like MTPB to identify interactions with both membrane and soluble proteins

• Proximity-dependent biotin identification (BioID): Fuse MTPB to a biotin ligase, express in plants, and identify proximal proteins through biotin labeling and affinity purification

These approaches will help identify components of MTPB-containing complexes and regulatory networks governing metal homeostasis in plants .

What structural domains are critical for MTPB function?

MTPB, like other members of the Cation Diffusion Facilitator (CDF) family, contains several critical structural domains that contribute to its function in metal transport. Analysis of the MTPB amino acid sequence reveals:

• Transmembrane domains: MTPB likely contains six transmembrane domains characteristic of CDF transporters, with the sequence showing hydrophobic regions consistent with membrane spanning segments (particularly evident in regions like "VMIGGGIIWVKPKWVLVDLICTLVFSAFALAATLPILKN")

• Metal binding sites: The protein contains histidine-rich regions (as seen in "HNHSHHHHDHHHHHHNHKHQHQHHHK") that typically coordinate metal ions, particularly zinc

• C-terminal domain: The C-terminal portion likely contains a cytoplasmic domain involved in metal sensing and protein-protein interactions

• N-terminal domain: The N-terminal region (MELEQICILKPDDEEEMESPSPSKTEENLGVVPLSCAFTRQEHCVSETKEREESTRRLSS) may contain regulatory elements and trafficking signals

To experimentally determine the functional importance of these domains, site-directed mutagenesis of conserved residues followed by complementation assays in yeast or Arabidopsis mtpb mutants would be required. Additionally, protein crystallography or cryo-EM studies could provide detailed structural information to correlate with functional analyses .

How can I establish a structure-activity relationship for MTPB?

Establishing a structure-activity relationship for MTPB requires a systematic approach combining structural analysis with functional assays. First, generate a reliable structural model using X-ray crystallography, cryo-electron microscopy, or homology modeling based on related CDF transporters with solved structures. Identify conserved residues through multiple sequence alignment with other MTPs and CDF proteins across species. Create a series of MTPB variants with point mutations, truncations, or domain swaps targeting metal-binding sites, transmembrane domains, and regulatory regions. Express these variants in heterologous systems (yeast mutants) and homologous systems (Arabidopsis mtpb knockout lines) using the super-expression system. Evaluate each variant's function through complementation assays, metal accumulation studies, and subcellular localization analysis. Quantify metal transport activity using radioisotope uptake assays or metal-sensitive fluorescent probes. The resulting data will reveal critical residues and domains essential for metal specificity, transport mechanism, regulation, and subcellular targeting, allowing construction of a comprehensive structure-activity map for MTPB .

How does MTPB differ from other metal tolerance proteins in Arabidopsis?

MTPB (MTP4) is part of a larger family of Metal Tolerance Proteins in Arabidopsis, with at least 12 members divided into different phylogenetic groups. Key differences among these proteins include:

• Metal specificity: While the exact metal specificity of MTPB is not explicitly stated in the search results, related proteins show distinct preferences - MTP3, for example, specifically transports zinc and cobalt. Other MTP family members may specialize in manganese, iron, or other metals.

• Subcellular localization: MTPs localize to different cellular compartments - some target the vacuolar membrane (like MTP3), while others may localize to the plasma membrane, Golgi, or other compartments. MTPB's specific localization would influence its role in metal homeostasis.

• Expression patterns: MTP3 shows strong induction under high zinc/cobalt or iron deficiency specifically in root epidermal and cortex cells. MTPB likely has its own distinct expression profile responding to specific metal stress conditions.

• Structural features: While all MTPs share the basic Cation Diffusion Facilitator (CDF) structure, MTPB has unique features including a specific histidine-rich region (HNHSHHHHDHHHHHHNHKHQHQHHHK) that may influence its metal binding properties.

These differences allow the various MTP proteins to contribute to a sophisticated network controlling metal homeostasis in different tissues, developmental stages, and stress conditions .

What experimental approaches can determine MTPB metal specificity and transport kinetics?

Determining MTPB metal specificity and transport kinetics requires multiple complementary approaches:

• Heterologous expression systems:

  • Express MTPB in metal-sensitive yeast mutants (zrc1cot1 for Zn, cot1 for Co, pmr1 for Mn)

  • Perform growth assays at varying metal concentrations to determine which metals are transported

  • Measure IC50 values for different metals to establish relative affinities

• Direct transport measurements:

  • Prepare vesicles from MTPB-expressing cells or reconstitute purified MTPB into liposomes

  • Conduct radioisotope uptake assays (65Zn, 57Co, 54Mn, etc.) at different substrate concentrations

  • Calculate kinetic parameters (Km, Vmax) for each metal substrate using Michaelis-Menten analysis

• Competitive inhibition studies:

  • Test transport of one metal in the presence of others to identify competitive relationships

  • Create a rank order of metal affinities based on inhibition constants (Ki)

• In planta analysis:

  • Compare metal accumulation profiles in wild-type, mtpb knockout, and MTPB-overexpressing plants

  • Use ICP-MS to quantify multiple metals simultaneously in different tissues and cellular compartments

  • Perform synchrotron X-ray fluorescence microscopy to visualize metal distribution at cellular resolution

These combined approaches will provide a comprehensive understanding of MTPB's metal transport properties, specificity, and physiological function .

How can I generate and analyze MTPB overexpression lines in Arabidopsis?

Generating and analyzing MTPB overexpression lines in Arabidopsis requires a systematic approach:

• Construct preparation:

  • Clone the full-length MTPB cDNA into a plant expression vector under a strong constitutive promoter (35S) or an inducible promoter

  • Include an epitope tag (His, FLAG, or GFP) for protein detection if needed

  • Verify the construct by sequencing

• Plant transformation:

  • Transform Arabidopsis using Agrobacterium-mediated floral dip method

  • Select primary transformants (T1) on media containing appropriate antibiotics

  • Grow plants to maturity and collect T2 seeds

• Transgenic line characterization:

  • Confirm MTPB overexpression by RT-qPCR and western blotting

  • Select lines with varying expression levels for comprehensive analysis

  • Verify protein localization using immunolocalization or fluorescence microscopy if using GFP fusion

• Phenotypic analysis:

  • Compare growth parameters of wild-type and MTPB-overexpressing plants under normal conditions

  • Challenge plants with different metal stresses (excess Zn, Co, Fe deficiency) and measure:
    a. Survival rates and visual symptoms
    b. Root and shoot growth
    c. Metal content in different tissues using ICP-MS
    d. Photosynthetic parameters
    e. Expression of other metal homeostasis genes

• Cellular analysis:

  • Examine subcellular metal distribution using specific fluorescent probes

  • Analyze changes in metal-dependent enzyme activities

  • Investigate alterations in root architecture and cellular organization

Expect MTPB overexpression to potentially enhance tolerance to specific metals and alter their accumulation patterns in different tissues, similar to effects seen with related proteins like MTP3 .

What phenotypic changes occur in MTPB knockout or silenced plants?

To understand the consequences of MTPB deficiency, researchers should generate and analyze knockout or silenced lines through the following methodology:

• Generation of MTPB-deficient plants:

  • Create knockout lines using TALEN or CRISPR-Cas9 targeting MTPB coding sequences

  • Alternatively, develop RNA interference (RNAi) constructs for MTPB silencing

  • Confirm gene disruption or silencing through genotyping, RT-qPCR, and western blot analysis

• Growth and development analysis:

  • Compare germination rates, seedling establishment, vegetative growth, and reproductive development

  • Measure root and shoot biomass under controlled conditions

  • Document any visible phenotypes including chlorosis, necrosis, or developmental abnormalities

• Metal stress responses:

  • Challenge plants with varying concentrations of different metals (particularly Zn, Fe, Co)

  • Assess metal sensitivity through survival rates, growth parameters, and visual symptoms

  • Examine responses to metal deficiency conditions, especially iron limitation

• Metal homeostasis analysis:

  • Quantify metal accumulation in different tissues using ICP-MS

  • Compare metal partitioning between roots and shoots

  • Analyze metal distribution at the cellular and subcellular levels

• Molecular responses:

  • Perform transcriptome analysis to identify compensatory mechanisms

  • Examine expression of other metal transporters and homeostasis genes

  • Investigate stress response pathways activation

Based on studies of related proteins like MTP3, MTPB-deficient plants might show hypersensitivity to specific metals and altered metal accumulation patterns, particularly under stress conditions. For example, MTP3-silenced plants showed enhanced zinc accumulation in above-ground organs and increased zinc sensitivity .

How has MTPB evolved across different plant species?

Understanding the evolutionary history of MTPB requires comparative genomic approaches across plant lineages:

• Phylogenetic analysis:

  • Identify MTPB homologs across diverse plant species from algae to angiosperms using BLAST searches

  • Construct multiple sequence alignments to identify conserved domains and species-specific variations

  • Build phylogenetic trees to visualize evolutionary relationships and duplication events

  • Calculate selection pressures (dN/dS ratios) on different protein domains

• Synteny analysis:

  • Examine genomic regions surrounding MTPB in different species to identify conserved gene neighborhoods

  • Track chromosomal rearrangements and duplication events that shaped MTPB evolution

  • Identify potential neofunctionalization or subfunctionalization events after gene duplication

• Protein domain architecture:

  • Compare metal-binding motifs, transmembrane domains, and regulatory regions across species

  • Identify lineage-specific insertions, deletions, or expansions (like the histidine-rich regions)

  • Correlate structural changes with environmental adaptations or metal exposure histories

• Expression pattern evolution:

  • Compare tissue-specific expression patterns and stress responses of MTPB orthologs

  • Analyze promoter regions for conserved and divergent regulatory elements

This evolutionary analysis would likely reveal that MTPB belongs to an ancient family of metal transporters with orthologs across the plant kingdom, showing diversification after whole-genome duplication events in the Brassicaceae family. The specific metal-binding domains and regulatory elements would show adaptive evolution correlating with environmental metal exposures in different plant lineages .

What can functional genomics approaches reveal about MTPB's role in plant metal homeostasis networks?

Functional genomics approaches can provide comprehensive insights into MTPB's position within the broader metal homeostasis network:

• Transcriptome analysis:

  • Compare gene expression profiles between wild-type and mtpb mutant plants under various metal stress conditions

  • Identify co-expressed genes that may function in the same pathways

  • Map transcriptional changes during metal stress exposure and recovery phases

• Proteome-level studies:

  • Perform quantitative proteomics to identify proteins affected by MTPB mutation

  • Use protein-protein interaction screening (Y2H, CoIP-MS) to identify MTPB interactors

  • Map post-translational modifications in response to metal status changes

• Metabolomic analysis:

  • Profile metal-related metabolites (organic acids, amino acids, chelators) in mtpb mutants

  • Quantify changes in the ionome (the mineral nutrient and trace element composition)

  • Correlate metabolite changes with metal distribution patterns

• Systems biology integration:

  • Construct network models incorporating transcriptomic, proteomic, and metabolomic data

  • Identify regulatory hubs and feedback mechanisms in metal homeostasis

  • Predict and validate synthetic interactions with other metal transport pathways

• Comparative analysis across stress conditions:

  • Analyze MTPB function across multiple stresses (metal excess, deficiency, oxidative stress)

  • Identify condition-specific protein interactions and regulation

This multi-omics approach would likely position MTPB within a complex network of transporters, chelators, and regulators that collectively maintain metal homeostasis, potentially revealing connections to zinc transport pathways based on its similarity to the characterized MTP3 protein .