Recombinant Arabidopsis thaliana Metal tolerance protein C1 (MTPC1)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Gene ID: AT2G47830 (Chromosome 2) .

  • Protein Length: 471 amino acids (Full-length) .

  • Molecular Weight: ~52 kDa (predicted).

  • Domains: Contains conserved transmembrane domains typical of CDF transporters .

  • Post-Translational Modifications: None reported; purity ≥85% (SDS-PAGE) .

Expression and Purification

  • Recombinant MTPC1 is successfully expressed in E. coli with high yields (~90% purity) .

  • MALDI-TOF/MS confirms protein identity via peptide fingerprinting (e.g., sequence LPADATLRDVVMVVR) .

Functional Validation

  • Metal Tolerance: Overexpression in plants enhances Zn²⁺ and Cd²⁺ tolerance .

  • Interaction Network: Partners with HMA4 (zinc ATPase) and ZIF1 (zinc facilitator) for metal trafficking .

Table 2: Functional Partners of MTPC1

ProteinRole in Metal HomeostasisInteraction Score
HMA4Cadmium/zinc ATPase; efflux pump0.945
MTP11Manganese transporter0.940
ZIF1Vacuolar zinc sequestration0.894

Biotechnological Applications

  • Phytoremediation: Engineered MTPC1 variants could enhance metal uptake in hyperaccumulator plants .

  • Stress-Resistant Crops: Modulating MTPC1 expression improves plant growth in metal-contaminated soils .

Current Challenges and Future Directions

  • Mechanistic Gaps: Exact metal-binding residues and transport kinetics require elucidation.

  • In Vivo Dynamics: Subcellular localization and regulation under biotic/abiotic stresses remain understudied .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MTPC1; MTP6; At2g47830; F17A22.22; Metal tolerance protein C1; AtMTPc1; AtMTP6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-471
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTPC1
Target Protein Sequence
MGIIRFQILNPTRICRSTIYYMSCRYLPSSSSSSSPLRVSSSSSQKPSFDFSRRWHFGHP DHHQQYQKPGEEGEKIFRLGLTADIGLSVAKALTGYLCGSTAIIADAAHSVSDVVLSGVA LVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSGIAWHALDLLSIALSAAPEVI HSGHHHGIDMNHPILALTVTIASISIKEGLYWITKRAGEKQGSGLMMANAWHHRSDAISS LVALVGVGGSILGVNFLDPLAGLVVSTMIVNAGLKTGHQSILELVDAAIPAQQLEPIRQT ILQVEGVKGCHRLRGRRAGSSLYLDVHIVVDPFSSVSVAHEVGEYVRRQINLNHPEVSEV FIHIDPAFLQFSCSTKDHDSITKESNICQEIKHVEATVSDIFSSQLSEKLTIKRITPHLL HSKILLQIVVAMPSTMSIQDVMIAAEHAEKEILKAAPNVARVSIQLSLNSE
Uniprot No.

Target Background

Function
Metal tolerance protein C1 (MTPC1) plays a role in sequestering excess metals from the cytoplasm into vacuoles, contributing to the maintenance of metal homeostasis within the cell.
Database Links

KEGG: ath:AT2G47830

STRING: 3702.AT2G47830.1

UniGene: At.43449

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is MTPC1 and what is its role in Arabidopsis thaliana?

MTPC1 (also known as MTP6, At2g47830, F17A22.22, AtMTPc1, or AtMTP6) is a member of the Metal Tolerance Protein family in Arabidopsis thaliana that plays a crucial role in metal homeostasis and tolerance. Similar to other MTP proteins like MTP1, it likely functions as a vacuolar transporter involved in metal sequestration, particularly zinc, contributing to the plant's ability to handle potentially toxic metal concentrations. The protein belongs to a broader network of metal transporters that regulate metal distribution and detoxification within plant cells, allowing the plant to survive in environments with varying metal concentrations .

What regulatory elements control MTPC1 expression in Arabidopsis thaliana?

Based on research with related MTP proteins, MTPC1 expression is likely controlled by a combination of cis-acting regulatory elements in its promoter region. Studies of MTP1 in Arabidopsis halleri have shown that specific elements like MYB-binding motifs play crucial roles in tissue-specific expression patterns and response to metal stress. For MTPC1, its promoter region may contain similar or distinct regulatory elements that control its expression under different environmental conditions and in various tissues. Detailed promoter analysis would be required to identify the specific regulatory elements governing MTPC1 expression .

What expression systems are optimal for producing recombinant MTPC1?

E. coli is a well-established expression system for producing recombinant MTPC1, as evidenced by the commercially available His-tagged protein. For optimal expression in E. coli, the protein coding sequence should be codon-optimized for bacterial expression and placed under the control of an inducible promoter (such as T7). Alternative expression systems may include yeast (Pichia pastoris or Saccharomyces cerevisiae) for proteins requiring eukaryotic post-translational modifications, or insect cell systems for membrane proteins that may not fold properly in bacterial systems. The choice of expression system should be guided by the specific experimental requirements and downstream applications .

What purification strategy should be employed for recombinant MTPC1?

For His-tagged recombinant MTPC1, a multi-step purification protocol is recommended:

  • Affinity chromatography using Ni-NTA resin as the primary purification step

  • Size exclusion chromatography to remove aggregates and achieve higher purity

  • Optional ion exchange chromatography if additional purification is required

The purification buffer should contain appropriate stabilizers and protease inhibitors. For the His-tagged MTPC1 protein described in the search results, the final product is provided as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0. Purification should be performed at 4°C to minimize protein degradation, and multiple small-scale optimization experiments are recommended before scaling up .

What are the optimal storage conditions for maintaining MTPC1 stability and activity?

Recombinant MTPC1 should be stored according to the following recommendations to maintain stability and activity:

Storage FormTemperatureBuffer CompositionAdditional Recommendations
Lyophilized-20°C to -80°CN/AMost stable form for long-term storage
Reconstituted4°CTris/PBS-based, pH 8.0For short-term use (up to one week)
Aliquoted-20°C to -80°CTris/PBS with 5-50% glycerolRecommended final glycerol concentration: 50%

Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and loss of activity. When reconstituting the lyophilized protein, it is advisable to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by the addition of glycerol for long-term storage aliquots .

How can functional assays be designed to study MTPC1's metal transport activity?

To investigate MTPC1's metal transport activity, researchers can employ several complementary approaches:

  • Yeast Functional Complementation: Transform metal-sensitive yeast mutants with MTPC1 expression constructs and assess growth restoration on metal-containing media.

  • Vesicle Transport Assays: Prepare inside-out membrane vesicles from cells expressing MTPC1 and measure metal uptake using radioactive isotopes or metal-sensitive fluorescent dyes.

  • Electrophysiological Methods: Utilize patch-clamp techniques on cells or proteoliposomes containing MTPC1 to directly measure metal ion currents.

  • Plant Transgenic Studies: Express MTPC1 under various promoters in Arabidopsis thaliana and assess phenotypic changes in metal tolerance and accumulation patterns.

These assays should include appropriate controls, such as empty vectors and known metal transporters, to validate MTPC1-specific effects .

What techniques can be used to study MTPC1 protein-protein interactions in metal homeostasis networks?

Several techniques can be employed to investigate MTPC1's protein-protein interactions:

TechniqueAdvantagesLimitationsNotes for MTPC1
Yeast Two-Hybrid (Y2H)Detects direct interactionsMay yield false positivesSplit MTPC1 into domains to reduce membrane protein constraints
Co-immunoprecipitation (Co-IP)Preserves native conditionsRequires specific antibodiesUse tagged MTPC1 if antibodies unavailable
Bimolecular Fluorescence Complementation (BiFC)Visualizes interactions in vivoMay force artificial interactionsOptimal for studying MTPC1 in plant cells
Proximity-Dependent Biotin Identification (BioID)Identifies proximal proteinsCan detect transient interactionsUseful for identifying MTPC1's interactome in native environment

When designing these experiments, consider MTPC1's membrane localization and ensure that the tags or modifications don't interfere with its native interactions .

How can site-directed mutagenesis be used to identify critical residues in MTPC1 function?

Site-directed mutagenesis represents a powerful approach to identify functional residues in MTPC1:

  • Target Selection: Identify conserved residues through sequence alignment with other MTP family members. Focus on predicted metal-binding sites, transmembrane domains, and regulatory regions.

  • Mutation Design: Create systematic mutations including:

    • Conservative substitutions to test chemical property requirements

    • Non-conservative substitutions to disrupt function

    • Alanine-scanning mutagenesis of specific domains

  • Functional Validation: Express mutant proteins in appropriate systems (bacteria, yeast, or plants) and assess:

    • Protein stability and expression levels

    • Subcellular localization

    • Metal binding capacity

    • Transport activity

  • Structure-Function Correlation: Map the effects of mutations onto predicted structural models to develop a comprehensive understanding of MTPC1's functional domains .

How does MTPC1 contribute to the broader metal tolerance network in Arabidopsis thaliana?

MTPC1 operates within a complex network of metal homeostasis proteins in Arabidopsis thaliana. Studies of related MTP proteins suggest that MTPC1 likely contributes to metal compartmentalization and detoxification. In hyperaccumulator species like Arabidopsis halleri, MTP1 serves as a key component of zinc hypertolerance through vacuolar sequestration. By analogy, MTPC1 may have specialized functions in handling specific metals or operating under particular stress conditions. Research indicates that differences in metal tolerance between species often reflect variations in transporter expression levels and regulation rather than protein sequence differences. Understanding MTPC1's role requires integrating transcriptomic, proteomic, and metabolomic approaches to map its interactions with other transporters, metal-binding proteins, and regulatory factors .

What evolutionary insights can be gained from comparing MTPC1 sequences across plant species?

Evolutionary analysis of MTPC1 across plant species can reveal important insights into metal tolerance adaptations:

  • Sequence Conservation: Identify highly conserved domains that likely represent essential functional regions versus variable regions that may contribute to species-specific adaptations.

  • Selection Pressure: Calculate Ka/Ks ratios to determine whether MTPC1 has undergone positive, negative, or neutral selection in different lineages, particularly in metal hyperaccumulators versus non-accumulators.

  • Gene Duplication Events: Analyze gene family expansion patterns, as seen with MTP1 in Arabidopsis halleri, where copy number variation contributes to increased expression and enhanced metal tolerance.

  • Promoter Evolution: Compare the regulatory regions of MTPC1 orthologs to identify evolved cis-regulatory elements that may drive differential expression patterns, similar to the MYB-binding motifs found in Arabidopsis halleri MTP1 promoters .

How can CRISPR-Cas9 technology be applied to study MTPC1 function in planta?

CRISPR-Cas9 technology offers powerful approaches for investigating MTPC1 function:

  • Gene Knockout: Design guide RNAs targeting MTPC1 coding regions to create null mutations and assess the resulting phenotypes regarding metal sensitivity, accumulation, and distribution.

  • Base Editing: Utilize CRISPR base editors to introduce specific amino acid substitutions without creating double-strand breaks, allowing precise testing of structure-function hypotheses.

  • Promoter Editing: Target regulatory regions to modify expression patterns, similar to the natural variation seen in MTP1 promoters between Arabidopsis species.

  • Protein Tagging: Implement CRISPR-mediated homology-directed repair to add fluorescent or affinity tags to the endogenous MTPC1 gene for tracking expression, localization, and interactions under native regulation.

  • Multiplexed Editing: Target MTPC1 alongside other metal homeostasis genes to uncover genetic interactions and compensatory mechanisms within the metal tolerance network .

What are common challenges in recombinant MTPC1 expression and how can they be overcome?

Researchers often encounter several challenges when expressing recombinant MTPC1:

ChallengePotential CausesSolution Strategies
Low expression yieldCodon bias, toxicity to hostOptimize codons, use tightly regulated induction systems, lower induction temperature (16-20°C)
Protein insolubilityImproper folding, inclusion body formationAdd solubility tags (MBP, SUMO), use specialized E. coli strains (Rosetta, Origami), include appropriate detergents
Protein degradationProtease activity, instabilityAdd protease inhibitors, reduce expression time, include stabilizing agents like trehalose (6%)
Loss of activityImproper folding, missing cofactorsSupplement with potential metal cofactors, optimize purification buffers
AggregationImproper storage, freeze-thaw cyclesAdd glycerol (5-50%), aliquot before freezing, maintain cold chain during purification

For membrane proteins like MTPC1, expression in eukaryotic systems might yield better results than bacterial systems in terms of proper folding and post-translational modifications .

How can researchers distinguish between MTPC1 and other MTP family members in functional studies?

To ensure specificity in MTPC1 research and avoid confounding effects from other MTP family members:

  • Design Specific Antibodies: Develop antibodies targeting unique epitopes in MTPC1 that are not conserved in other MTP proteins. These can be used for western blotting, immunolocalization, and immunoprecipitation experiments.

  • Gene-Specific Silencing: Utilize RNAi or CRISPR technologies targeting unique regions of MTPC1 mRNA or gene, respectively. Confirm specificity by quantifying expression levels of other MTP family members.

  • Unique Functional Assays: Exploit any metal specificity or kinetic parameters unique to MTPC1 in transport assays to differentiate its activity from other transporters.

  • Heterologous Expression: Express MTPC1 in systems lacking endogenous MTP proteins, such as yeast mutants deficient in metal transport, to assess its specific contribution to phenotypes.

  • Promoter Analysis: Study MTPC1-specific expression patterns using reporter constructs driven by its native promoter, which may show unique tissue or condition specificity compared to other MTP genes .

What considerations are important when interpreting MTPC1 localization studies?

When conducting and interpreting MTPC1 localization studies, researchers should consider several critical factors:

  • Tag Position Effect: The position of fluorescent or epitope tags (N-terminal vs. C-terminal) may affect MTPC1 trafficking and localization. Always validate with multiple tag positions and compare with untagged protein localization when possible.

  • Overexpression Artifacts: Expression levels significantly higher than endogenous levels may cause mislocalization. Use native promoters or inducible systems with titratable expression.

  • Cell Type Specificity: MTPC1 localization may vary across different cell types, similar to how MTP1 shows differential expression patterns including in trichomes. Examine multiple tissues and cell types.

  • Dynamic Relocalization: MTPC1 may relocalize in response to metal stress or other environmental cues. Time-course experiments under various conditions are recommended.

  • Co-localization Controls: Always include appropriate organelle markers, particularly for vacuolar and endosomal compartments, to precisely determine MTPC1's subcellular distribution.

  • Resolution Limitations: Consider the limitations of light microscopy and complement with biochemical fractionation or electron microscopy for definitive localization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.