Recombinant Arabidopsis thaliana Metal tolerance protein C2 (MTPC2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Metal Transport and Homeostasis

MTPC2 belongs to the MTP (Metal Tolerance Protein) family, which facilitates the transport of divalent cations (e.g., Zn²⁺, Fe²⁺) across membranes.

Key Functions

  1. Zinc Transport:

    • Acts as a zinc transporter 7 (ZT7), exporting Zn²⁺ from cytosol to subcellular compartments (e.g., Golgi apparatus) .

    • Interacts with AtMTP12 to form functional complexes for Zn²⁺ translocation .

  2. Antagonistic Metal Regulation:

    • Competes with other transporters (e.g., IAR1) to modulate metal ion availability in subcellular compartments, influencing auxin conjugate metabolism .

    • mtp5 mutants (defective in MTPC2) restore IAA-amino acid conjugate sensitivity in iar1 mutants, suggesting MTPC2 sequesters metals away from hydrolase-active compartments .

  3. Cross-Species Conservation:

    • Homologs like AhMTPC2.1 in peanut (Arachis hypogaea) correlate with Zn²⁺ and Fe²⁺ translocation from roots to shoots, indicating conserved roles in metal regulation .

Alternative Splicing and Isoforms

MTPC2 undergoes alternative splicing, producing two transcripts:

  • MTP5-A: Encodes a functional transporter (312 bp product after PvuII digestion) .

  • MTP5-B: Non-functional isoform (246 bp + 66 bp products) .

Mutant Phenotypes:

MutantMutation TypePhenotype
mtp5-1Frameshift (splicing error)Loss of function; restores IAA-conjugate sensitivity in iar1 mutants .
mtp5-2UnspecifiedNo intact mRNA detected; confirmed via RT-PCR .

Experimental Utility

  • Recombinant Protein: Used in ELISA, Western blot, and metal transport assays .

  • Yeast Complementation: Tested for Zn²⁺/Co²⁺ resistance but showed no functional complementation in cot1 zrc1 mutants, suggesting species-specific localization or substrate specificity .

Key Research Questions

  1. Mechanism of Metal Selectivity: How MTPC2 distinguishes between Zn²⁺, Fe²⁺, and other cations?

  2. Subcellular Localization: Confirmed vacuolar or Golgi localization remains unresolved .

  3. Functional Redundancy: Potential overlap with other MCTPs (Multiple C2 domain proteins) in flowering time regulation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MTPC2; MTP5; At3g12100; T21B14.8; Metal tolerance protein C2; AtMTPc2; AtMTP5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MTPC2
Target Protein Sequence
MERSISFNPRGDNELPDDRSSDVGYAANDRRLAYSRSFQQSHGPRTPAVTEAAKPFLDRT VSSIDMPPDIYSVDGSDVFFGEGKDVDMAKVSVLEMVWEVFGVVTSGNRQMKRLFLLIAL NVLYSTTELSIGIFTGRVGLVSDAFHLTFGCGLLTFSLFAMATSRKKPDHAYSYGYKRLE VLSAFTNALFLMFMSFSLAVEALHAFIQDESEHKHYLIVSAVTNLLVNLLGVWFFRNYAR VNIAYRKAEDMNYHSVCLHVISDSIRSAGLILASWLLSLGVENAEVLCLGLVSVTVFMLV MPLFKATGGVLLQMAPPNIPSSALSKCLRQITSREDVTEVLQARFWEVVPGHTVGSLRLQ VKSGIDERPLLQYVYDVYHDLGVQDLTLQTDYT
Uniprot No.

Target Background

Function
MTPC2 is involved in sequestering excess cytoplasmic metal into vacuoles, thus maintaining cellular metal homeostasis.
Gene References Into Functions
  1. MTP5 and IAR1 exhibit antagonistic metal transport to regulate metal homeostasis. PMID: 23316445
Database Links

KEGG: ath:AT3G12100

STRING: 3702.AT3G12100.1

UniGene: At.39645

Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

How can recombinant MTPC2 be expressed and purified for research applications?

Recombinant MTPC2 can be successfully expressed in E. coli expression systems using the full-length sequence (1-393 amino acids) . The standard approach involves constructing an expression vector containing the MTPC2 coding sequence fused to an N-terminal His-tag to facilitate purification. After transformation into an appropriate E. coli strain, protein expression is typically induced under optimized conditions. The recombinant protein can then be purified using nickel affinity chromatography, taking advantage of the His-tag fusion.

For storage and handling, the purified protein is often formulated in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 and lyophilized for longer-term stability . When reconstituting the protein, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for aliquots intended for long-term storage at -20°C/-80°C . To maintain protein integrity, working aliquots should be stored at 4°C for no more than one week, and repeated freeze-thaw cycles should be avoided .

What experimental systems are used to study MTPC2 function in plants?

Several experimental systems have been developed to study MTPC2 function in relation to metal tolerance:

  • Relative Root Growth (RRG) Assays: This approach measures root growth of seedlings under metal stress compared to control conditions. Plants are grown on media containing varying concentrations of metals like cadmium, zinc, or copper, and the relative inhibition of root growth is quantified as a phenotypic indicator of metal tolerance .

  • Genetic Variation Studies: Comparing different Arabidopsis accessions (such as Col-0 and Bur-0) with varying metal tolerance levels helps identify natural genetic variation in metal response pathways. This approach has revealed significant differences in tolerance to cadmium and zinc between accessions, with tolerance levels ranging from 31±5% to 60±12% RRG for cadmium .

  • Hydroponic Growth Systems: These allow for controlled exposure to metals and facilitate easy access to root tissue for metal accumulation analysis. Metal content in both roots and shoots can be measured to assess the role of transporters like MTPC2 in metal distribution .

  • Recombinant Protein Functional Assays: Using purified recombinant MTPC2 protein for in vitro transport assays or structural studies to determine metal binding properties and transport mechanisms .

How does genetic variation in MTPC2 contribute to differential metal tolerance among Arabidopsis accessions?

Genetic variation in metal tolerance genes, including potentially MTPC2, contributes significantly to phenotypic differences observed among Arabidopsis accessions. Research using recombinant inbred line (RIL) populations derived from accessions with contrasting metal tolerance (such as Col-0 and Bur-0) has revealed:

  • QTL Analysis Results: Three major QTLs have been identified that together explain nearly 50% of the variation in cadmium tolerance between certain accessions . While MTPC2 itself has not been specifically identified as a causative gene within these QTLs, its role as part of the metal homeostasis network makes it a potential contributor to the observed tolerance differences.

  • Correlation Between Metal Tolerances: Strong correlation (r = 0.7, P < 0.001) between zinc and cadmium tolerance in RIL populations suggests shared genetic mechanisms controlling tolerance to different metals . This indicates that genes like MTPC2 might have pleiotropic effects on multiple metal tolerance traits.

  • Accession-Specific Responses: Transcriptome analyses of accessions with differing metal tolerance (e.g., Col-0 and Bur-0) have revealed both common and accession-specific responses to cadmium exposure. More tolerant accessions appear to activate acclimative responses more efficiently and may exhibit reduced metal accumulation .

To investigate MTPC2 genetic variation specifically, researchers would need to:

  • Sequence and compare MTPC2 alleles from multiple accessions

  • Perform complementation studies with different MTPC2 alleles in sensitive backgrounds

  • Analyze expression levels and regulation of MTPC2 across accessions under various metal stress conditions

What methodologies are most effective for studying MTPC2's subcellular localization and trafficking?

Understanding MTPC2's subcellular localization is critical for elucidating its precise function in metal homeostasis. Several complementary approaches can be employed:

  • Fluorescent Protein Fusion Studies:

    • Construct N- or C-terminal GFP/YFP fusions with MTPC2

    • Express in Arabidopsis protoplasts or stable transgenic lines

    • Visualize using confocal microscopy

    • Co-localize with established organelle markers (vacuolar, Golgi, endosomal, etc.)

  • Immunolocalization:

    • Generate specific antibodies against MTPC2 or use anti-His antibodies with recombinant protein

    • Perform immunofluorescence microscopy on fixed plant cells

    • Use gold-labeled secondary antibodies for transmission electron microscopy to achieve higher resolution localization

  • Biochemical Fractionation:

    • Isolate subcellular fractions (plasma membrane, tonoplast, etc.)

    • Detect MTPC2 using Western blotting

    • Verify fraction purity using established marker proteins

  • Protein Trafficking Studies:

    • Use inducible expression systems to track newly synthesized MTPC2

    • Apply trafficking inhibitors (Brefeldin A, wortmannin) to determine trafficking routes

    • Perform pulse-chase experiments to monitor protein movement between compartments

These approaches should be combined with functional assays to correlate localization with metal transport activity, potentially using metal-sensitive fluorescent probes or radioactive metal isotopes to track transport in vivo.

How can functional assays be designed to measure MTPC2-mediated metal transport?

Designing robust functional assays for MTPC2-mediated metal transport requires multiple complementary approaches:

  • Heterologous Expression Systems:

    • Express MTPC2 in yeast mutants deficient in metal transporters

    • Assess growth complementation under varying metal concentrations

    • Measure intracellular metal accumulation using ICP-MS (Inductively Coupled Plasma Mass Spectrometry)

  • Reconstitution in Artificial Membrane Systems:

    • Purify recombinant MTPC2 protein with intact structure

    • Reconstitute in liposomes loaded with fluorescent metal indicators

    • Measure metal-dependent fluorescence changes to quantify transport

  • Electrophysiological Methods:

    • Express MTPC2 in Xenopus oocytes or patch-clamp compatible cell lines

    • Perform two-electrode voltage clamp or patch-clamp recordings

    • Characterize metal-dependent currents and transport kinetics

  • In Planta Metal Accumulation:

    • Generate MTPC2 overexpression and knockout/knockdown lines

    • Compare metal distribution between plant tissues and subcellular compartments

    • Analyze using techniques such as ICP-MS and synchrotron X-ray fluorescence microscopy

A comprehensive functional analysis would include measurement of transport kinetics (Km, Vmax), metal selectivity profiles, pH dependence, and effects of potential inhibitors or regulatory factors.

What is known about the structure-function relationship of MTPC2 and how can it be further explored?

The structure-function relationship of MTPC2 remains largely unexplored, but researchers can apply several approaches to advance this understanding:

  • Site-Directed Mutagenesis:

    • Identify conserved residues likely involved in metal binding or transport

    • Create systematic mutations and test their effect on function

    • Focus on histidine, cysteine, and acidic residues that often coordinate metal ions

  • Protein Crystallography or Cryo-EM:

    • Purify sufficient quantities of stable, homogeneous recombinant MTPC2

    • Optimize conditions for crystal formation or cryo-EM sample preparation

    • Determine three-dimensional structure, potentially in different metal-bound states

  • Protein Domain Analysis:

    • Construct truncated versions of MTPC2 containing specific domains

    • Assess function of individual domains in metal binding and transport

    • Identify critical regions for protein-protein interactions or regulation

  • Cross-Linking and Mass Spectrometry:

    • Use chemical cross-linking to capture MTPC2 in native conformations

    • Analyze by mass spectrometry to identify spatial relationships between domains

    • Develop molecular models of protein structure and dynamics

These approaches would significantly advance understanding of how MTPC2 structure relates to its function in metal transport and homeostasis.

How can MTPC2 research contribute to crop improvement for metal-contaminated soils?

Research on MTPC2 and related metal tolerance proteins has significant potential applications for crop improvement in metal-contaminated environments:

  • Biofortification Strategies:

    • Engineering crops with modified MTPC2 expression or improved variants could enhance accumulation of essential micronutrients (zinc, iron) while excluding toxic metals

    • This dual approach could address both micronutrient deficiency and heavy metal toxicity in food crops

  • Phytoremediation Applications:

    • Plants with enhanced MTPC2 function could potentially be developed for phytoremediation of contaminated soils

    • Understanding the natural variation in metal tolerance genes like MTPC2 helps identify genetic resources for breeding metal-tolerant crops

  • Predictive Modeling:

    • Combining knowledge of MTPC2 function with QTL mapping data could facilitate marker-assisted selection for metal tolerance traits

    • The correlation between tolerance to different metals (r = 0.7 between zinc and cadmium tolerance) suggests that improvements in one aspect of metal tolerance might provide broader benefits

  • Translational Research:

    • Comparing MTPC2 function across species could identify evolutionarily conserved mechanisms that could be targeted in multiple crop species

    • Insights from model systems like Arabidopsis can guide similar studies in crops with complex genomes

Future research should explore how MTPC2 interacts with other components of the metal homeostasis network and how these interactions are affected by environmental factors like soil pH, organic matter content, and microbial communities.

What techniques are available for analyzing MTPC2 interaction partners and regulatory networks?

Understanding MTPC2's interaction partners and regulatory networks is crucial for elucidating its role in metal homeostasis. Several complementary techniques can be employed:

  • Yeast Two-Hybrid (Y2H) Screening:

    • Use MTPC2 or specific domains as bait to screen Arabidopsis cDNA libraries

    • Validate interactions by pairwise Y2H assays

    • Test interactions in the presence of different metal ions to identify metal-dependent interactions

  • Co-Immunoprecipitation (Co-IP):

    • Express tagged MTPC2 in Arabidopsis or heterologous systems

    • Perform Co-IP followed by mass spectrometry to identify interacting proteins

    • Confirm specific interactions with Western blotting

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse MTPC2 and candidate interactors with complementary fragments of fluorescent proteins

    • Express in plant cells and visualize reconstituted fluorescence at interaction sites

    • Determine subcellular localization of protein complexes

  • Transcriptional Network Analysis:

    • Perform RNA-Seq under various metal stress conditions comparing wild-type and MTPC2 mutants

    • Identify differentially expressed genes to construct regulatory networks

    • Use existing comparative transcriptome data from accessions with varying metal tolerance (e.g., Col-0 vs. Bur-0)

  • Chromatin Immunoprecipitation (ChIP-Seq):

    • Identify transcription factors regulating MTPC2 expression

    • Map regulatory elements in the MTPC2 promoter region

    • Compare regulatory patterns across accessions with different metal tolerance profiles

These approaches can reveal the broader context of MTPC2 function within cellular metal homeostasis networks and identify potential targets for manipulating metal tolerance traits.

How do environmental factors influence MTPC2 expression and function?

Environmental factors significantly impact metal tolerance mechanisms, including MTPC2 function. Researchers interested in these interactions should consider:

  • Metal-Specific Responses:

    • Different metals (Cd, Zn, Cu) trigger distinct plant responses, with certain accessions showing metal-specific tolerance patterns

    • MTPC2 expression and function may be differentially regulated depending on the specific metal stressor

  • Dose-Dependent Effects:

    • Plants show dose-dependent growth reduction when treated with metals like Cd or excess Zn

    • At 2 μM CdCl₂, significant differences in tolerance are observed between accessions (e.g., Bur-0 reaching 74±20% RRG while Col-0 reaches only 41±7%)

    • Experimental designs should include multiple concentration points to capture these response patterns

  • Tissue-Specific Accumulation:

    • Metal accumulation varies between root and shoot tissues and between accessions

    • Bur-0 consistently shows lower Cd accumulation relative to Col-0 in both roots and shoots when grown in medium with varying Cd concentrations

    • Analysis techniques should include tissue-specific measurements using methods like ICP-MS

  • Cross-Talk with Other Nutrients:

    • Metal tolerance mechanisms interact with other nutrient homeostasis systems

    • Fe contents of Bur-0 roots were consistently lower under all tested metal stress conditions

    • Comprehensive analysis should include measurements of multiple elements (Fe, Mn, etc.)

  • Developmental Stage Effects:

    • Metal tolerance varies depending on plant age and developmental stage

    • Experimental approaches should test multiple growth stages to capture developmental differences in MTPC2 function

Understanding these environmental interactions is crucial for developing complete models of MTPC2 function and for designing effective strategies to enhance plant performance under metal stress conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.