Recombinant Arabidopsis thaliana Methylsterol monooxygenase 1-3 (SMO1-3)

Shipped with Ice Packs
In Stock

Description

Introduction to Methylsterol monooxygenase 1-3

Methylsterol monooxygenase 1-3 (SMO1-3) is one of three sterol 4α-methyl oxidases in the SMO1 family found in Arabidopsis thaliana, commonly known as mouse-ear cress. These enzymes catalyze a critical step in sterol biosynthesis by removing the first methyl group at the C-4 position of sterols . The enzyme belongs to a family of sterol 4α-methyl oxidases that are essential for proper plant development, particularly during embryogenesis. While SMO2 enzymes (responsible for removing the second methyl group) have been extensively studied and shown to be critical for both embryonic and post-embryonic development, the specific roles of SMO1 enzymes, including SMO1-3, have only recently been elucidated .

SMO1-3 is encoded by the SMO1-3 gene (At4g22753) and is officially designated as a methylsterol monooxygenase with the Enzyme Commission number 1.14.13.72 . The protein is also alternatively known as sterol 4-alpha-methyl-oxidase 1-3 or AtSMO1-3 in scientific literature . Understanding this enzyme's function provides valuable insights into plant sterol metabolism and its downstream effects on plant development.

Gene Structure and Expression

The SMO1-3 gene in Arabidopsis thaliana exhibits a specific expression pattern that differs from other members of the SMO1 family. Studies using promoter-GUS reporter gene constructs have revealed that SMO1-3 is expressed in various tissues throughout the plant . The expression pattern of SMO1-3 provides valuable insights into its functional roles in different plant tissues.

Analysis of GUS staining in transgenic plants has demonstrated that SMO1-3 is particularly expressed in certain plant tissues. While the search results do not provide complete specific information about SMO1-3 expression patterns alone, comparative analysis of the SMO1 family genes indicates that SMO1-3 shares high sequence similarity with SMO1-2, suggesting possibly overlapping functions .

Sterol Biosynthetic Pathway

In the plant sterol biosynthetic pathway, SMO1-3 functions as part of the SMO1 family of enzymes that are responsible for the removal of the first methyl group at the C-4 position of sterols . This demethylation step is critical for the production of functional sterols that serve as essential components of cell membranes and as precursors for plant hormones.

The functional significance of SMO1-3 becomes evident when examining the effects of mutations in the SMO1 genes. Research has shown that while single smo1 mutants show no obvious phenotypic abnormalities, certain double mutant combinations exhibit severe developmental defects . This suggests functional redundancy among the three SMO1 genes in Arabidopsis thaliana, with SMO1-3 potentially compensating for the loss of other SMO1 family members.

Role in Embryogenesis

These developmental defects in smo1 mutants are associated with disruptions in hormone homeostasis. Specifically, embryos with defective SMO1 function show enhanced and ectopic expression of auxin biosynthesis and response elements, along with altered expression patterns and polar localization of auxin transporters such as PIN FORMED1, PIN FORMED7, and AUXIN RESISTANT1 . Simultaneously, cytokinin biosynthesis and response are reduced in these embryos .

The critical link between SMO1 function and hormone regulation is further supported by experiments showing that the application of either auxin biosynthesis inhibitors or cytokinin can partially rescue the embryo lethality of smo1-1 smo1-2 double mutants . This indicates that the SMO1 family, including SMO1-3, functions by maintaining the correct sterol composition necessary for balancing auxin and cytokinin activities during embryogenesis .

SMO1 Family and Redundancy

The Arabidopsis thaliana genome contains three SMO1 genes (SMO1-1, SMO1-2, and SMO1-3) that exhibit different expression patterns but show functional redundancy . The amino acid sequences of these proteins, particularly SMO1-2 and SMO1-3, show high similarity, suggesting evolutionary conservation of their important functions .

Studies of mutant phenotypes have provided valuable insights into the redundancy within the SMO1 family. While single smo1 mutants and smo1-1 smo1-3 double mutants displayed no obvious phenotypic abnormalities, the smo1-1 smo1-2 double mutant was embryo lethal . This pattern of redundancy suggests that SMO1-3 may share functional overlap with SMO1-1, but not with SMO1-2.

Table 2: Comparative Analysis of SMO1 Family Mutants in Arabidopsis thaliana

Mutant CombinationPhenotypeObservations
Single smo1 mutantsNo obvious phenotypeFunctional redundancy among SMO1 family members
smo1-1 smo1-3 double mutantNo obvious phenotypeSMO1-2 can compensate for loss of both SMO1-1 and SMO1-3
smo1-1 smo1-2 double mutantEmbryo lethalSevere developmental defects including no cotyledon formation
smo1-2 smo1-3 double mutantNot specifically reported in search results-

Biochemical analyses have revealed that 4,4-dimethylsterols dramatically accumulate in smo1-1 smo1-2 heterozygous mutants, confirming the direct involvement of these enzymes in sterol metabolism . This sterol imbalance appears to be the molecular basis for the observed defects in hormone homeostasis and embryonic development.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us. We will prioritize development of the specified tag.
Synonyms
SMO1-3; At4g22755; T12H17.140; Methylsterol monooxygenase 1-3; Sterol 4-alpha-methyl-oxidase 1-3; AtSMO1-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SMO1-3
Target Protein Sequence
MIPYPTVEDASVALGRNLTWFETVWFDYSATKSNFHVYCHTILVLFLVFSLAPFPLVIVE WTGWFDQFKIQKKVKYSLSDMFQCYKEVMKLFLLVVGTLQIVSYPSIQMVGIRSGLPLPS LMEIVAQLVVYFLIEDYTNYWIHRWMHCKWGYEKIHRIHHEYTSPIGYASPYAHWAEILI LGIPTFLGPAIAPGHIMTFWLWISLRQFEAIETHSGYDFPWSVTKLIPFYGGPEYHDYHH YVGGQSQSNFASVFTYCDYIYGTDKGYRIHKKLLHHQIKEEAEEKRVRKHD
Uniprot No.

Target Background

Function
Non-heme iron oxygenase involved in sterols biosynthesis. 4,4-dimethyl-9-beta,19-cyclopropylsterols such as 24-methylenecycloartanol are the preferred substrates.
Database Links
Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of SMO1-3 in the sterol biosynthetic pathway?

SMO1 enzymes catalyze a critical oxidative demethylation step in sterol biosynthesis, specifically removing the first methyl group at the C-4 position of 4,4-dimethylsterols. Within the complex sterol biosynthetic pathway (which involves at least 25 steps from isopentenyl diphosphate to end pathway sterols), SMO1 enzymes function in the post-squalene portion of the pathway . The three Arabidopsis SMO1 isoforms (SMO1-1, SMO1-2, and SMO1-3) work coordinately to maintain proper sterol composition, which is essential for normal plant development, particularly embryogenesis . Their activity directly affects the balance between 4,4-dimethylsterols and downstream sterols, which impacts membrane integrity and various signaling pathways, particularly auxin and cytokinin hormonal responses .

What are the most effective expression systems for producing recombinant SMO1-3 proteins?

For recombinant expression of Arabidopsis SMO1 proteins, heterologous systems using bacterial expression vectors have proven successful for related sterol biosynthetic enzymes. Similar to the successful expression of Arabidopsis 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR), expression of only the soluble catalytic domain (rather than the full-length protein including membrane-spanning regions) generally yields higher activity . When expressing membrane-bound enzymes like SMO1, removing the transmembrane domains and expressing only the catalytic portion often results in higher protein solubility and activity. For functional studies, complementation systems using yeast mutants defective in sterol biosynthesis (similar to successful approaches with other sterol pathway enzymes) could provide valuable functional validation . Yeast expression vectors like pFL61 have been successfully used for expressing and characterizing other Arabidopsis sterol biosynthetic enzymes .

How are the three SMO1 genes differentially expressed throughout plant development?

The three Arabidopsis SMO1 genes exhibit distinct but partially overlapping expression patterns throughout plant development, suggesting specialized functions:

SMO1-1 Expression:

  • Strong expression in most plant tissues

  • Prominent in leaf vascular tissues and stomata

  • Strong expression in root stele and lateral root formation sites

  • Highly expressed in anthers, pistil, and seedpods

  • During embryogenesis, detected in both embryo and endosperm at globular stage

  • Strongly expressed in provascular cells of developing hypocotyl and shoot apical meristem from torpedo to mature embryo stages

SMO1-2 Expression:

  • Detected in leaf vascular tissues but not in stomata

  • Strongest expression in root tip, particularly in root stem cell niche and columella cells

  • Highly expressed in flower style, petals, and anther filaments

  • Expressed in funiculi in siliques

  • Shows the strongest expression among the three genes throughout embryo development

  • Particularly strong in embryonic root meristem from torpedo to mature embryo stages

SMO1-3 Expression:

  • Weakest expression among the three genes

  • Limited to vascular tissues of leaves and roots

  • In flowers, detected in petal vascular tissues, anther filaments, and style

  • Expressed in funiculi in siliques

  • Evenly expressed throughout the embryo from torpedo to mature stages, but at lower levels than the other isoforms

What transcriptional factors regulate SMO1 gene expression?

While the search results don't directly address the specific transcription factors that regulate SMO1 gene expression, the differential expression patterns suggest complex transcriptional regulation. The coordinated expression of the three SMO1 genes during embryogenesis and post-embryonic development indicates shared regulatory mechanisms . Based on expression analyses, these genes likely respond to developmental cues and tissue-specific transcription factors that govern embryonic patterning, vascular development, and reproductive tissue formation. The strong expression of SMO1-2 in the root stem cell niche suggests potential regulation by transcription factors involved in root meristem maintenance . Further research using promoter analysis and chromatin immunoprecipitation would be necessary to identify the specific transcription factors that bind to SMO1 promoters and regulate their expression in different developmental contexts.

What are the best methods for analyzing SMO1-3 expression patterns in plant tissues?

Based on successful approaches described in the research, the following methods are effective for analyzing SMO1-3 expression patterns:

Promoter-Reporter Gene Fusion:

  • Generate constructs with promoter fragments of each SMO1 gene driving a GUS reporter gene

  • Transform these constructs into wild-type Arabidopsis

  • Perform histochemical GUS staining to visualize expression patterns in different tissues

  • This approach successfully revealed the distinct expression patterns of the three SMO1 genes in various tissues and developmental stages

Transcriptome Analysis:

  • Utilize existing transcriptome databases (such as the one generated by the Raju Datla laboratory)

  • Extract expression data specific to SMO1 genes across different developmental stages

  • This approach confirmed the GUS expression patterns and provided quantitative expression data

RT-PCR and qRT-PCR:

  • Design gene-specific primers to differentiate between the three highly similar SMO1 transcripts

  • Perform reverse transcription-PCR or quantitative real-time PCR on RNA isolated from different tissues and developmental stages

  • This approach can provide quantitative measurements of expression levels

In Situ Hybridization:

  • Develop gene-specific probes for each SMO1 isoform

  • Perform in situ hybridization on tissue sections to visualize transcript localization at cellular resolution

  • This method would be particularly valuable for confirming expression patterns in embryos and meristematic regions

What are the challenges in expressing recombinant SMO1-3 proteins and how can they be overcome?

Expressing recombinant SMO1-3 proteins presents several challenges due to their nature as membrane-bound enzymes. Based on experiences with related enzymes like HMGR, the following challenges and solutions can be identified:

Challenges:

  • Membrane association reduces solubility and expression efficiency

  • Full-length proteins may form inclusion bodies in bacterial expression systems

  • Correct folding and post-translational modifications may be impaired in heterologous systems

  • Enzyme activity may require specific membrane environments or cofactors

Solutions:

  • Truncated Constructs: Express only the soluble catalytic domain, as demonstrated successful with HMGR where "expression of a truncated form comprising only the soluble domain led to the formation of a highly active enzyme"

  • Fusion Tags: Use solubility-enhancing fusion tags (MBP, SUMO, etc.) to improve protein solubility

  • Expression Conditions: Optimize temperature, induction conditions, and host strain selection for membrane protein expression

  • Alternative Expression Systems: Consider eukaryotic expression systems like yeast, insect cells, or plant-based expression systems for proteins requiring post-translational modifications

  • Complementation Assays: Use functional complementation of yeast mutants defective in sterol biosynthesis to confirm enzymatic activity, similar to approaches used for other sterol pathway enzymes

  • In vitro Reconstitution: Develop membrane reconstitution systems with appropriate lipid compositions to study enzyme activity in a native-like environment

What are the most reliable assays for measuring SMO1-3 enzyme activity?

Based on methodologies applied to related sterol biosynthetic enzymes, the following assays would be most reliable for measuring SMO1-3 enzyme activity:

In Vitro Enzyme Assays:

  • Substrate Conversion Assay: Incubate purified recombinant SMO1 enzymes with 4,4-dimethylsterol substrates and necessary cofactors, then measure the conversion to 4α-methylsterols using chromatographic methods (HPLC, GC-MS)

  • Coupled Enzyme Assays: Develop coupled assays where the product of SMO1 activity feeds into a secondary reaction that produces a measurable signal

  • Radioisotope Labeling: Use radiolabeled substrates to track the conversion and measure enzyme kinetics with high sensitivity

In Vivo Functional Assays:

  • Yeast Complementation: Express Arabidopsis SMO1 genes in yeast mutants defective in the orthologous sterol biosynthesis step and measure restored sterol production or growth phenotypes

  • Metabolic Profiling: Compare sterol profiles in wild-type, SMO1 mutant, and SMO1-overexpressing plants using LC-MS or GC-MS to quantify substrate accumulation and product formation

  • Inducible Expression Systems: Develop plant lines with inducible SMO1 expression and measure changes in sterol composition upon induction

Structure-Function Analysis:

  • Site-Directed Mutagenesis: Create targeted mutations in predicted catalytic residues and measure the effect on enzyme activity

  • Domain Swapping: Exchange domains between different SMO1 isoforms to determine regions responsible for substrate specificity or catalytic efficiency

These approaches would provide comprehensive insights into SMO1-3 enzymatic activity and their specific roles in sterol biosynthesis.

What are the key phenotypes observed in SMO1 single and double mutants?

The phenotypes of SMO1 mutants vary significantly depending on which genes are disrupted:

Single smo1 Mutants:

  • No obvious phenotypes observed in any of the three single mutants (smo1-1, smo1-2, or smo1-3)

  • This suggests functional redundancy among the three SMO1 isoforms

smo1-1 smo1-3 Double Mutant:

smo1-1 smo1-2 Double Mutant:

  • Embryo lethal (homozygous double mutant cannot be recovered)

  • Approximately one-quarter of seeds in heterozygous mutant siliques (smo1-1/+ smo1-2 and smo1-1 smo1-2/+) are aborted white seeds (23.2% and 24.7%, respectively)

  • Embryo development arrests around the late globular stage

  • Multiple severe embryonic defects observed:

    • No cotyledon or shoot apical meristem formation

    • Abnormal division of suspensor cells

    • Twin embryo formation

    • Embryo proper fails to develop past a ball-like structure

smo1-1 smo1-2/+ Seedling Phenotypes:

  • Lumpy root phenotype

  • Shorter root length compared to wild-type

  • Altered response to vesicle trafficking inhibitors (Brefeldin A)

These phenotypes demonstrate that SMO1-1 and SMO1-2 play critical and partially overlapping roles in embryo development, while SMO1-3 appears to have a more limited or specialized function.

How does SMO1 deficiency affect hormone signaling during plant development?

SMO1 deficiency, particularly in the smo1-1 smo1-2 double mutant, profoundly disrupts hormone signaling during plant development, with the most significant effects on auxin and cytokinin balance:

Effects on Auxin:

  • Enhanced biosynthesis: smo1-1 smo1-2 embryos show enhanced expression of auxin biosynthesis reporters

  • Ectopic auxin response: Auxin response markers show abnormal and ectopic expression patterns

  • Altered auxin transport: Expression pattern and polar localization of auxin transporters (PIN FORMED1, PIN FORMED7, and AUXIN RESISTANT1) are dramatically altered

  • Disrupted PIN1 cycling: The smo1-1 smo1-2/+ mutant shows differences in formation and clearance of Brefeldin A (BFA) bodies, indicating altered vesicle trafficking of PIN1 proteins between the plasma membrane and endosomes

Effects on Cytokinin:

  • Reduced biosynthesis: Cytokinin biosynthesis is reduced in smo1-1 smo1-2 embryos

  • Decreased cytokinin response: Cytokinin response markers show reduced expression

Hormone Balance Disruption:

  • The balance between auxin and cytokinin is severely altered in smo1-1 smo1-2 embryos

  • This disturbed balance is accompanied by unrestricted expression of the quiescent center marker WUSCHEL-RELATED HOMEOBOX5

  • Tissue culture experiments with root segments from heterozygous mutants confirm altered responses to different auxin:cytokinin ratios

  • Exogenous application of either auxin biosynthesis inhibitors or cytokinin can partially rescue the embryo lethality of smo1-1 smo1-2, confirming that hormone imbalance contributes significantly to the mutant phenotype

These findings demonstrate that SMO1-dependent sterol composition plays a crucial role in maintaining proper hormone homeostasis during plant development, particularly embryogenesis.

How can CRISPR-Cas9 technology be optimized for creating SMO1 knockout lines?

While the search results don't directly address CRISPR-Cas9 approaches for SMO1 genes, the following optimization strategies can be recommended based on what we know about these genes:

Target Site Selection:

  • Design guide RNAs targeting unique regions of each SMO1 gene to prevent off-target effects, despite their sequence similarity

  • Target early exons to ensure complete loss-of-function

  • Analyze the entire SMO1 gene family to identify regions that differ between paralogs for isoform-specific targeting

  • Consider targeting conserved catalytic domains if the goal is to disrupt enzymatic function across multiple isoforms

Multiplex CRISPR Strategies:

  • Use multiplex CRISPR systems to target multiple SMO1 genes simultaneously, addressing functional redundancy issues

  • Design polycistronic constructs expressing multiple guide RNAs to create double or triple mutants in a single transformation

  • Consider inducible or tissue-specific CRISPR systems for genes like SMO1-1/SMO1-2 where double mutants are embryo lethal

Efficiency Optimization:

  • Use optimized Cas9 variants with higher specificity and activity in plants

  • Employ egg cell-specific or germ-line-specific promoters to increase heritable editing efficiency

  • Consider temperature optimization during transformation and regeneration to enhance Cas9 activity

Screening and Validation:

  • Develop high-throughput screening methods using sterol profile analysis

  • Implement targeted deep sequencing to identify successful editing events

  • Use sterol composition analysis by GC-MS to confirm functional effects of mutations

  • Employ RT-qPCR to verify transcript levels of targeted and non-targeted SMO1 genes

Rescue Strategies:

  • For embryo-lethal combinations (like smo1-1 smo1-2), prepare complementation constructs in advance

  • Consider inducible rescue systems to study gene function at specific developmental stages

  • Develop tissue-specific rescue constructs to understand organ-specific requirements

This comprehensive approach would enable efficient generation of SMO1 mutant combinations while addressing the challenges posed by gene redundancy and embryo lethality.

How does 4,4-dimethylsterol accumulation affect membrane properties in SMO1 mutants?

The smo1-1 smo1-2 heterozygous mutants show dramatic accumulation of 4,4-dimethylsterols due to impaired demethylation at the C-4 position . While the search results don't directly describe the membrane property changes, the following effects can be inferred based on sterol biochemistry and the observed phenotypes:

Membrane Structural Changes:

  • Accumulation of 4,4-dimethylsterols likely alters membrane fluidity and permeability

  • The bulkier 4,4-dimethyl groups may disrupt normal sterol packing in membrane microdomains

  • These structural changes can affect membrane protein distribution and function

Functional Consequences:

  • Vesicle Trafficking: The observed alterations in PIN1 cycling and BFA body formation/clearance in smo1-1 smo1-2/+ mutants suggest impaired vesicle trafficking

  • Protein Localization: The altered polar localization of PIN transporters indicates defects in protein targeting or stability in membranes

  • Signaling Platforms: Disruption of sterol-rich membrane microdomains may impair hormone receptor function and downstream signaling

These membrane alterations likely contribute significantly to the developmental defects observed in SMO1 mutants, particularly through their effects on auxin transport and signaling machinery. The partial rescue of mutant phenotypes by hormone treatments suggests that membrane-dependent hormone transport and signaling are primary targets of the altered sterol composition .

What is the relationship between SMO1 activity and other rate-limiting enzymes in the sterol biosynthetic pathway?

While the search results don't directly address interactions between SMO1 and other rate-limiting enzymes, the sterol biosynthetic pathway involves coordinated activity of multiple enzymes:

Relationship with HMGR:

  • 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR) is a well-established rate-limiting enzyme for plant sterol biosynthesis

  • HMGR catalyzes an early step in the pathway, while SMO1 functions in post-squalene sterol biosynthesis

  • HMGR regulation is complex and occurs at transcriptional, translational, and post-translational levels

  • SMO1 activity may influence HMGR regulation through feedback mechanisms, as seen in other sterol biosynthetic pathways

Coordination with Other Sterol Biosynthetic Enzymes:

  • SMO1 works in concert with SMO2 enzymes (which remove the second methyl group at C-4)

  • While SMO1s are essential for embryonic development, SMO2s have also been found essential for both embryonic and postembryonic development

  • The sterol biosynthetic pathway involves at least 25 steps from isopentenyl diphosphate to end pathway sterols , requiring tight coordination among enzymes

Regulatory Network:

  • Mevalonate kinase (MVK) is considered a potential regulatory enzyme in the isoprenoid biosynthetic pathway

  • 5-phosphomevalonate kinase (PMVK) and mevalonate diphosphate decarboxylase (MVDPD) are also key enzymes in the pathway

  • The sterol pathway likely involves complex regulatory networks to balance flux through different branches of isoprenoid metabolism

A full understanding of SMO1's place in this regulatory network would require metabolic flux analysis and enzyme activity studies across different developmental stages and in response to various environmental conditions.

How can isotope labeling experiments be designed to track sterol flux in SMO1 mutant backgrounds?

Isotope labeling experiments would be valuable for understanding altered sterol metabolic flux in SMO1 mutants. The following experimental approaches are recommended:

Feeding Experiments with Labeled Precursors:

  • Early Pathway Precursors:

    • Provide plants with 13C-labeled acetate or 13C-glucose to track carbon incorporation into the entire sterol pathway

    • Compare labeling patterns between wild-type and SMO1 mutants to identify changes in pathway flux

    • Analyze samples at multiple time points to determine kinetics of label incorporation

  • Pathway-Specific Intermediates:

    • Feed plants with labeled mevalonate or later intermediates to focus on post-MVA pathway dynamics

    • Use deuterium-labeled lanosterol or cycloartenol to specifically track post-squalene metabolism

    • Analyze accumulation of labeled 4,4-dimethylsterols in mutants compared to conversion to downstream sterols in wild-type

Analytical Methods:

  • MS-Based Analysis:

    • Employ GC-MS or LC-MS/MS to detect isotope-labeled sterol intermediates and products

    • Use multiple reaction monitoring (MRM) for sensitive detection of labeled sterols

    • Implement metabolic flux analysis (MFA) calculations to quantify changes in pathway dynamics

  • Tissue-Specific Analysis:

    • Develop microdissection techniques coupled with sensitive MS detection to analyze tissue-specific sterol metabolism

    • Compare sterol profiles in embryos versus maternal tissues in heterozygous plants

    • Implement imaging mass spectrometry to visualize spatial distribution of sterols

Experimental Design:

\begin{table}
\caption{Isotope Labeling Experimental Design for SMO1 Mutant Analysis}
\begin{tabular}{llll}
\hline
\textbf{Genotype} & \textbf{Labeled Precursor} & \textbf{Sampling Time Points} & \textbf{Tissues Analyzed} \
\hline
Wild-type & $^{13}$C-acetate & 6h, 12h, 24h, 48h & Whole seedlings, isolated embryos \
smo1-1 mutant & $^{13}$C-acetate & 6h, 12h, 24h, 48h & Whole seedlings, isolated embryos \
smo1-2 mutant & $^{13}$C-acetate & 6h, 12h, 24h, 48h & Whole seedlings, isolated embryos \
smo1-3 mutant & $^{13}$C-acetate & 6h, 12h, 24h, 48h & Whole seedlings, isolated embryos \
smo1-1 smo1-3 & $^{13}$C-acetate & 6h, 12h, 24h, 48h & Whole seedlings, isolated embryos \
smo1-1/+ smo1-2 & $^{13}$C-acetate & 6h, 12h, 24h, 48h & Whole seedlings, isolated embryos \
\hline
\end{tabular}
\end{table}

By analyzing the patterns and kinetics of isotope incorporation, researchers can determine:

  • Whether flux through the early sterol pathway is altered in SMO1 mutants

  • The extent of metabolic bottlenecks at the C4-demethylation steps

  • Whether alternative pathways are activated to compensate for SMO1 deficiency

  • The tissue-specific requirements for different SMO1 isoforms in sterol metabolism

What mechanisms link SMO1-dependent sterol composition to auxin transport and signaling?

The research reveals several mechanisms that connect SMO1-dependent sterol composition to auxin transport and signaling:

Effects on PIN Protein Localization and Trafficking:

  • In smo1-1 smo1-2 embryos, the expression pattern and polar localization of auxin transporters (PIN FORMED1, PIN FORMED7, and AUXIN RESISTANT1) are dramatically altered

  • Brefeldin A (BFA) treatment experiments show that SMO1 deficiency affects PIN1 protein cycling between the plasma membrane and endosomes

  • After BFA washout, smo1-1 smo1-2/+ root cells retain significantly more BFA bodies than wild-type, indicating impaired vesicle trafficking recovery

Sterol-Dependent Membrane Organization:

  • Altered sterol composition likely disrupts membrane microdomains ("lipid rafts") that serve as platforms for protein organization

  • PIN proteins require specific membrane environments for proper localization and function

  • The accumulation of 4,4-dimethylsterols in SMO1 mutants may alter membrane properties in ways that impair PIN trafficking machinery

Feedback on Auxin Biosynthesis:

  • SMO1 deficiency leads to enhanced expression of auxin biosynthesis reporters

  • This suggests either a compensatory response to impaired auxin transport or direct sterol-dependent regulation of auxin biosynthetic enzymes

Developmental Consequences:

  • The disrupted auxin transport and signaling leads to severe developmental defects, including:

    • Failure to establish proper embryo patterning

    • Abnormal division of suspensor cells

    • Formation of twin embryos

    • Absence of cotyledon and shoot apical meristem formation

  • Exogenous application of auxin biosynthesis inhibitors can partially rescue the embryo lethality of smo1-1 smo1-2, confirming that excessive or mislocalized auxin contributes to the developmental defects

These findings establish a clear link between sterol composition, membrane trafficking of auxin transporters, and plant developmental patterning, highlighting the essential role of SMO1 enzymes in these processes.

How can auxin and cytokinin treatments be optimized to rescue SMO1 mutant phenotypes?

Based on the research finding that exogenous hormone treatments can partially rescue smo1-1 smo1-2 phenotypes, the following optimization strategies are recommended:

Auxin Inhibitor Treatments:

  • Concentration Optimization:

    • Test a range of concentrations of auxin biosynthesis inhibitors (e.g., L-kynurenine, yucasin)

    • Determine the minimal effective dose that reduces auxin levels without causing developmental defects

    • Develop a dose-response curve specific to SMO1 mutant backgrounds

  • Timing Optimization:

    • Apply treatments at different developmental stages to identify critical windows for rescue

    • For embryo rescue, apply treatments to siliques at specific days after pollination

    • For seedling phenotypes, develop stage-specific application protocols

  • Delivery Methods:

    • Compare efficiency of silique injection, spraying, and growth medium supplementation

    • Develop targeted delivery systems for tissue-specific effects

    • Consider inducible expression of auxin-degrading enzymes as an alternative approach

Cytokinin Treatments:

  • Cytokinin Type Selection:

    • Test different cytokinin types (zeatin, kinetin, 6-benzylaminopurine) for differential rescue efficiency

    • The research utilized kinetin in combination with 2,4-dichlorophenoxy acetic acid (2,4-D) in tissue culture experiments

    • Compare natural and synthetic cytokinins for efficacy and specificity

  • Concentration Optimization:

    • Test concentrations ranging from 100 nM to 4 μM as used in the tissue culture experiments

    • Determine optimal concentration ratios between auxin and cytokinin for different developmental contexts

Combined Hormone Approach:

  • Balanced Treatments:

    • Develop protocols that combine reduced auxin (through biosynthesis inhibitors) with moderate cytokinin supplementation

    • Test different auxin:cytokinin ratios to optimize rescue efficiency

    • Consider sequential treatments rather than simultaneous application

  • Genetic Approach:

    • Combine chemical treatments with genetic modifications of hormone biosynthesis or signaling

    • Introduce inducible expression of genes that modulate hormone levels specifically in SMO1 mutant backgrounds

Evaluation Methods:

  • Quantitative Phenotyping:

    • Develop scoring systems for embryo development stages

    • Use root growth and architecture measurements for seedling phenotypes

    • Implement automated image analysis for high-throughput phenotyping

  • Molecular Markers:

    • Monitor expression of hormone response markers to confirm treatment efficacy

    • Track developmental markers to assess rescue of specific developmental processes

    • Analyze sterol profiles to determine if treatments affect sterol metabolism

These comprehensive approaches would enable researchers to develop optimal hormone treatment protocols for studying SMO1 function and potentially rescuing mutant phenotypes for further developmental studies.

What implications do SMO1 studies have for understanding broader connections between membrane sterols and developmental patterning?

The studies on SMO1 enzymes provide significant insights into how membrane sterol composition influences plant developmental patterning:

Fundamental Principles Revealed:

  • Sterol-Dependent Protein Trafficking:

    • The altered PIN protein localization and trafficking in SMO1 mutants demonstrates that specific sterol compositions are required for proper membrane protein dynamics

    • This principle likely extends to other developmental regulators that require polar localization or membrane-associated trafficking

  • Hormone Transport-Development Nexus:

    • SMO1 studies reveal how sterol-dependent changes in hormone transport directly translate to altered developmental patterning

    • The embryonic defects in smo1-1 smo1-2 mutants provide a clear example of how membrane composition affects cell fate specification and pattern formation

  • Tissue-Specific Sterol Requirements:

    • The differential expression patterns of SMO1 isoforms suggest tissue-specific requirements for particular sterol compositions

    • This may explain why certain developmental processes are more sensitive to sterol perturbations than others

Broader Implications:

  • Evolutionary Insights:

    • The conservation of sterol biosynthesis across eukaryotes suggests fundamental roles in development

    • Comparing the developmental functions of sterols across plant species could reveal evolutionary adaptations in pattern formation mechanisms

  • Cell Polarity Establishment:

    • SMO1 studies support the model that sterols are crucial for establishing and maintaining cell polarity

    • The defects in auxin transport protein localization demonstrate how sterol-rich membrane domains may serve as organizational platforms for polarity establishment

  • Membrane Domain Organization:

    • The research supports the importance of sterol-dependent membrane microdomains in organizing developmental signaling platforms

    • This concept may extend to other signaling pathways beyond auxin and cytokinin

  • Metabolic-Developmental Integration:

    • SMO1 research demonstrates how primary metabolism (sterol biosynthesis) directly impacts developmental regulatory networks

    • This illustrates the concept that metabolic state can influence developmental decisions through effects on membrane properties

Future Research Directions:

  • Investigating sterol composition at the cellular and subcellular levels during key developmental transitions

  • Exploring how environmental factors affect sterol metabolism and subsequent developmental outcomes

  • Determining if other developmental signaling pathways (e.g., brassinosteroids, gibberellins) are similarly affected by altered sterol profiles

  • Developing models that integrate sterol metabolism, membrane properties, protein trafficking, and developmental patterning across different plant tissues

These insights from SMO1 research provide a foundation for understanding how cellular metabolism influences development through effects on membrane organization and protein trafficking.

How can synthetic biology approaches be used to modulate SMO1 activity for enhanced plant development?

Synthetic biology offers several promising approaches to modulate SMO1 activity for enhanced plant development:

Precision Engineering of SMO1 Genes:

  • Promoter Engineering:

    • Design synthetic promoters with tissue-specific or inducible expression patterns

    • Create chimeric promoters combining regulatory elements from different SMO1 genes to optimize expression

    • Develop feedback-regulated promoters that respond to sterol levels or developmental signals

  • Protein Engineering:

    • Design SMO1 variants with enhanced catalytic efficiency through rational protein design

    • Create chimeric enzymes combining domains from different SMO1 isoforms to optimize substrate specificity or regulatory properties

    • Introduce post-translational regulation modules for dynamic control of enzyme activity

Advanced Regulatory Systems:

  • Optogenetic Control:

    • Develop light-responsive SMO1 variants by fusing photosensitive domains

    • Enable spatial and temporal control of sterol biosynthesis using light patterns

    • Create reversible systems for experimental manipulation of sterol metabolism

  • Synthetic Circuits:

    • Design genetic circuits that coordinate SMO1 expression with other sterol biosynthetic enzymes

    • Create toggle switches or oscillators that dynamically regulate sterol composition

    • Implement feedback loops that maintain optimal sterol profiles during development

Multi-Omics Guided Approaches:

These synthetic biology approaches would enable precise manipulation of sterol metabolism to enhance plant development, stress resistance, and agricultural productivity while advancing our fundamental understanding of sterol function in plant biology.

What high-throughput screening methods can identify small molecule modulators of SMO1 activity?

Developing high-throughput screening methods to identify small molecule modulators of SMO1 activity would advance both basic research and potential agricultural applications:

In Vitro Enzymatic Assays:

  • Fluorescence-Based Assays:

    • Develop fluorogenic substrates that produce a signal upon SMO1-catalyzed demethylation

    • Create coupled enzyme assays where SMO1 activity is linked to a fluorescent signal

    • Adapt to 384 or 1536-well format for ultra-high-throughput screening

  • Mass Spectrometry-Based Screens:

    • Implement rapid LC-MS/MS detection of reaction products in a multiplexed format

    • Use stable isotope-labeled internal standards for quantitative analysis

    • Develop automated sample preparation and analysis workflows

Cell-Based Screening Systems:

  • Yeast-Based Platforms:

    • Engineer yeast strains where growth depends on functional SMO1 activity

    • Create reporter systems where SMO1 activity is coupled to fluorescent protein expression

    • Implement competitive growth assays to identify selective SMO1 modulators

  • Plant Cell Culture Systems:

    • Develop plant cell lines with sterol-responsive fluorescent reporters

    • Create high-content imaging assays to detect changes in sterol-dependent processes

    • Implement protoplast-based transient assays for rapid screening

In Planta Screening Approaches:

  • Phenotypic Screens:

    • Use SMO1 mutant lines with visible phenotypes for rescue screens

    • Develop quantitative phenotyping pipelines using automated imaging and analysis

    • Create developmental stage-specific screening conditions

  • Reporter Systems:

    • Generate plants with sterol-responsive promoters driving luciferase or fluorescent proteins

    • Develop high-throughput imaging systems for whole-plant reporter activity

    • Create dual-reporter systems to monitor SMO1 activity and downstream effects simultaneously

Compound Libraries and Analysis:

  • Focused Libraries:

    • Screen libraries enriched for compounds that target oxidoreductases

    • Include natural products with known effects on sterol metabolism

    • Design structure-based virtual screening to identify potential SMO1 binders

  • Data Analysis:

    • Implement machine learning algorithms to identify structure-activity relationships

    • Develop computational models to predict compound effects on sterol profiles

    • Create integrated analysis pipelines connecting compound structures to phenotypic outcomes

These high-throughput screening approaches would enable identification of SMO1 activators, inhibitors, and modulators for further development as research tools or agricultural chemicals for manipulating plant development.

How might knowledge of SMO1 function contribute to crop improvement strategies?

Understanding SMO1 function has significant potential for developing novel crop improvement strategies:

Optimizing Plant Architecture and Development:

  • Root System Enhancement:

    • Given SMO1-2's strong expression in root meristems , targeted modulation could enhance root architecture

    • Develop varieties with optimized SMO1 expression for improved drought resistance through enhanced root growth

    • Fine-tune sterol composition in root tissues to improve nutrient uptake efficiency

  • Reproductive Development:

    • Leverage the role of SMO1 in reproductive tissues to improve flowering, fertilization, and seed development

    • Optimize expression in siliques and developing seeds to increase yield and seed quality

    • Develop strategies to enhance seed size or number through targeted sterol modulation

Stress Tolerance Enhancement:

  • Membrane Stability:

    • Optimize sterol composition for improved membrane integrity under temperature stress

    • Develop crops with enhanced SMO1 activity in tissues particularly vulnerable to stress damage

    • Create varieties with sterol profiles that maintain membrane fluidity across a wider temperature range

  • Hormone Response Modulation:

    • Fine-tune auxin and cytokinin balance through SMO1-mediated sterol composition adjustments

    • Develop crops with optimized hormone responses for specific environmental conditions

    • Create varieties with enhanced resilience to hormone-disrupting stresses

Biotechnological Approaches:

  • Precision Breeding:

    • Identify natural variants of SMO1 genes associated with desirable agronomic traits

    • Use marker-assisted selection to incorporate optimal SMO1 alleles into elite varieties

    • Employ genomic selection models that incorporate sterol metabolism genes

  • Genetic Engineering:

    • Develop tissue-specific or stress-inducible SMO1 expression systems

    • Create balanced modifications of multiple sterol biosynthetic enzymes for optimized profiles

    • Implement synthetic biology approaches to create novel regulatory circuits controlling sterol metabolism

  • Chemical Modulation:

    • Develop SMO1-targeted agrochemicals for temporal control of plant development

    • Create seed treatments that transiently modulate sterol metabolism during germination

    • Design precision agriculture approaches using SMO1 modulators at specific growth stages

These approaches leverage fundamental knowledge of SMO1 function to develop practical crop improvement strategies addressing major agricultural challenges including yield optimization, climate resilience, and resource use efficiency.

What are the remaining key questions about SMO1 enzymes that warrant further investigation?

Despite significant advances in understanding SMO1 enzymes, several key questions remain unanswered:

Structural Biology:

  • What are the three-dimensional structures of plant SMO1 enzymes, and how do they differ from mammalian and fungal orthologs?

  • What structural features determine substrate specificity among the three SMO1 isoforms?

  • How do membrane interactions influence SMO1 enzyme activity and regulation?

Enzyme Mechanism:

  • What is the detailed catalytic mechanism of plant SMO1 enzymes?

  • How is electron transfer coordinated during the oxidative demethylation reaction?

  • What cofactors are required for optimal SMO1 activity in plants?

Regulation and Integration:

  • How is SMO1 activity regulated at post-translational levels?

  • What transcription factors directly control SMO1 gene expression?

  • How is SMO1 activity coordinated with other enzymes in the sterol biosynthetic pathway?

  • What environmental factors modulate SMO1 expression and activity?

Developmental Functions:

  • What are the precise tissue-specific roles of each SMO1 isoform?

  • How do SMO1 enzymes influence specific developmental transitions beyond embryogenesis?

  • What are the molecular mechanisms connecting sterol composition to developmental patterning?

  • How does sterol composition affect specific membrane properties in different cell types?

Hormone Interactions:

  • Beyond auxin and cytokinin, how does SMO1-dependent sterol composition affect other hormone signaling pathways?

  • What specific membrane domains are affected by altered sterol composition in SMO1 mutants?

  • How do sterols directly or indirectly influence hormone transporter trafficking?

Evolutionary Aspects:

  • How has the specialization of SMO1 isoforms evolved across plant lineages?

  • What functional differences exist between SMO1 enzymes in different plant species?

  • How have SMO1 functions co-evolved with plant developmental mechanisms?

Addressing these questions would significantly advance our understanding of plant sterol metabolism and its developmental implications.

How can systems biology approaches integrate SMO1 function into broader metabolic and developmental networks?

Systems biology offers powerful approaches to integrate SMO1 function into comprehensive metabolic and developmental frameworks:

Multi-Omics Integration:

  • Integrated Data Analysis:

    • Combine transcriptomics, proteomics, metabolomics, and phenomics data from SMO1 mutants

    • Develop computational methods to correlate sterol profiles with transcriptional changes

    • Create multi-layer network models connecting sterol metabolism to developmental regulation

  • Temporal and Spatial Resolution:

    • Implement single-cell or tissue-specific multi-omics approaches

    • Develop time-course analyses to capture dynamic responses to SMO1 perturbation

    • Create spatially resolved models of sterol metabolism across different tissues and cell types

Network Modeling:

  • Metabolic Flux Analysis:

    • Develop isotope-assisted metabolic flux models of the sterol pathway

    • Integrate sterol biosynthesis with broader isoprenoid metabolism

    • Create dynamic models that capture developmental stage-specific flux patterns

  • Regulatory Network Inference:

    • Identify transcriptional regulatory networks controlling SMO1 expression

    • Map signaling networks connecting sterol composition to developmental regulators

    • Develop causal network models linking sterol metabolism to hormone signaling

  • Multi-Scale Modeling:

    • Connect molecular-level sterol interactions to cellular membrane properties

    • Link cellular-level processes to tissue-level developmental patterning

    • Develop whole-plant models of sterol metabolism and its developmental consequences

Integrative Experimental Approaches:

  • Perturbation Analysis:

    • Systematically perturb multiple points in sterol metabolism and related pathways

    • Create comprehensive genetic interaction maps for sterol biosynthetic enzymes

    • Analyze combinatorial effects of environmental factors and genetic variations

  • Synthetic Circuit Testing:

    • Design minimal synthetic systems to test network predictions

    • Implement optogenetic or chemically-inducible perturbation systems

    • Create biosensors to monitor dynamic system responses in vivo

These systems biology approaches would transform our understanding of SMO1 from individual enzymes to integral components of plant developmental regulation, enabling more comprehensive models of how metabolism influences plant form and function.

What collaborative research initiatives would advance SMO1 understanding across multiple disciplines?

Advancing our understanding of SMO1 enzymes would benefit from collaborative research initiatives spanning multiple disciplines:

Interdisciplinary Research Consortium:

  • Core Research Areas:

    • Plant Biochemistry: Enzyme characterization, sterol analytics, protein structure

    • Developmental Biology: Embryogenesis, organogenesis, hormone signaling

    • Cell Biology: Membrane dynamics, protein trafficking, cell polarity

    • Genetics: Mutant analysis, gene regulation, genetic interactions

    • Computational Biology: Modeling, network analysis, systems integration

  • Collaborative Projects:

    • Comprehensive SMO1 structural biology initiative

    • Plant sterol "atlas" across species, tissues, and developmental stages

    • Multi-omics analysis of sterol functions in plant development

    • Synthetic biology toolkit for manipulating sterol metabolism

    • Translational research for crop improvement applications

Technological Integration:

  • Technology Platforms:

    • Advanced imaging (super-resolution, correlative microscopy, live imaging)

    • Metabolomics (targeted and untargeted sterol analysis)

    • Single-cell omics for tissue-specific resolution

    • CRISPR toolkits for precise genetic manipulation

    • Computational resources for integrative data analysis

  • Method Development:

    • Spatially resolved sterol analysis techniques

    • High-sensitivity assays for sterol-protein interactions

    • Advanced membrane biophysics tools for plant systems

    • Plant-specific synthetic biology components

Knowledge Sharing and Integration:

  • Database Development:

    • Create comprehensive plant sterol databases integrating:

      • Structural information

      • Biosynthetic pathways

      • Tissue-specific profiles

      • Developmental dynamics

      • Mutant phenotypes

    • Develop visualization tools for complex sterol datasets

  • Training and Education:

    • Interdisciplinary workshops on plant lipid biology

    • Method-sharing initiatives across research groups

    • Early career researcher exchanges between labs with complementary expertise

    • Development of teaching resources on plant sterol biology

Such collaborative initiatives would accelerate discovery by bringing together diverse expertise, technologies, and perspectives to address the complex questions surrounding SMO1 function in plant biology.

Experimental Protocols

For researchers working with recombinant Arabidopsis thaliana SMO1-3, the following optimized protocols are recommended based on successful approaches with related enzymes:

Protein Expression Protocol:

  • Clone the soluble catalytic domain of SMO1 (removing transmembrane regions) into a bacterial expression vector with an N-terminal His-tag

  • Transform into E. coli BL21(DE3) or similar expression strain

  • Culture at 18°C after induction with 0.5 mM IPTG for optimal soluble protein production

  • Purify using nickel affinity chromatography followed by size exclusion chromatography

Sterol Extraction and Analysis Protocol:

  • Harvest 100-500 mg plant tissue and freeze immediately in liquid nitrogen

  • Grind tissue to fine powder while maintaining freezing temperatures

  • Extract with chloroform:methanol (2:1) mixture

  • Perform saponification to separate free sterols

  • Analyze using GC-MS or LC-MS/MS with appropriate sterol standards

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.