Recombinant Arabidopsis thaliana Methylsterol monooxygenase 2-2 (SMO2-2)

Shipped with Ice Packs
In Stock

Description

Biological Role in Arabidopsis Development

SMO2-2 is functionally redundant with SMO2-1 but exhibits distinct expression patterns:

  • Embryogenesis: Critical for embryo viability, as smo2-1 smo2-2 double mutants are embryonic lethal .

  • Auxin Signaling: Regulates auxin accumulation and PIN1 expression, impacting embryonic patterning and postembryonic growth .

  • Sterol Composition: Converts 4α-methylsterols (e.g., 24-ethylidenelophenol) to 4α-carboxysterols, maintaining membrane integrity .

Table 2: Phenotypic Effects of SMO2-2 Mutations

GenotypePhenotypeRescue Mechanism
smo2-1 smo2-2Embryonic lethalityPartial rescue via auxin/YUC9
smo2-1 smo2-2/+DwarfismFull rescue via YUC9 OE
smo2-1/+ smo2-2Moderate developmental defectsNot reported

Gas chromatography-mass spectrometry (GC-MS) analyses confirm 4α-methylsterol accumulation in mutants, linking SMO2-2 activity to sterol homeostasis .

Research Applications

Recombinant SMO2-2 is widely used to study:

  1. Sterol Biosynthesis Pathways: Elucidating plant-specific sterol modification steps .

  2. Auxin Crosstalk: Investigating sterol-auxin interactions during embryogenesis .

  3. Enzyme Kinetics: Substrate specificity assays using 24-ethylidenelophenol .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SMO2-2; SMO1; At1g07420; F22G5.23; Methylsterol monooxygenase 2-2; Sterol 4-alpha-methyl-oxidase 1; AtSMO1; Sterol 4-alpha-methyl-oxidase 2-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
SMO2-2
Target Protein Sequence
MASFVESGWQYLVTHFSDFQLACIGSFLLHESVFFLSGLPFIFLERQGFLSKYKIQTKNN TPAAQGKCITRLLLYHFSVNLPLMLASYPVFRAMGMRSSFPLPSWKEVSAQILFYFIIED FVFYWGHRILHSKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHL ITLWLWMVLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVY MDWIFGTDKGYRRLKTLKENGDMKQT
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana Methylsterol monooxygenase 2-2 (SMO2-2) is a non-heme iron oxygenase involved in sterol biosynthesis. 24-ethylidenelophenol and 24-ethyllophenol are its preferred substrates.
Gene References Into Functions
  1. SMO2-1 plays a crucial role in maintaining proper sterol composition and function, partly through its influence on auxin accumulation and response, thereby regulating Arabidopsis embryogenesis and postembryonic development. PMID: 27006488
  2. SMO2 is a functional homolog of Saccharomyces cerevisiae TRM112. Its disruption primarily inhibits G2-M phase progression during organogenesis. PMID: 19929876
Database Links

KEGG: ath:AT1G07420

STRING: 3702.AT1G07420.1

UniGene: At.27344

Protein Families
Sterol desaturase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SMO2-2 and what are its alternative nomenclatures?

SMO2-2 (Methylsterol monooxygenase 2-2) is a protein encoded by Arabidopsis thaliana that functions as a sterol 4-alpha-methyl-oxidase. The protein is known by several alternative names including SMO2-1, SMO1, ATSMO2, F22G5.23, F22G5_23, and sterol 4-alpha-methyl-oxidase 2-1 . The enzyme is classified under EC 1.14.13.72 and is involved in sterol biosynthesis pathways. SMO2 is a functional homologue of yeast TRM112, which suggests evolutionary conservation of this protein across different organisms . When designing experiments targeting this protein, researchers should be aware of these various nomenclatures to ensure comprehensive literature reviews and proper experimental design.

What are the basic phenotypic characteristics of smo2 knockout mutants?

The smo2 knockout mutant displays several distinct phenotypic characteristics compared to wild-type Arabidopsis. Most notably, the mutant exhibits reduced size of aerial organs and shortened roots due to decreased cell numbers in these organs . Additionally, smo2 shows an obvious delay in seed germination, with wild-type seeds beginning germination at approximately 16 hours after stratification and completing germination by 24 hours, while smo2 seeds begin germination at 20 hours and require up to 48 hours to complete the process . The knockout mutant also exhibits hypersensitivity to abscisic acid (ABA) during germination, with significantly lower percentages of cotyledon greening in ABA-supplemented media compared to wild-type plants . These phenotypic characteristics indicate SMO2's importance in both developmental processes and hormone response pathways.

How can researchers obtain and work with recombinant SMO2-2 protein?

Recombinant SMO2-2 protein is commercially available with a purity greater than or equal to 85% as determined by SDS-PAGE . Researchers can obtain this protein from suppliers using expression systems including cell-free expression systems, E. coli, yeast, baculovirus, or mammalian cells . When working with this protein, it's important to follow standard protein handling protocols, including proper storage at recommended temperatures (typically -80°C for long-term storage) and avoiding repeated freeze-thaw cycles. For detection and quantification in experimental samples, researchers can utilize commercially available polyclonal antibodies against SMO2-2, which are suitable for applications including Western blotting and ELISA .

What is the role of SMO2 in cell division and how can researchers measure its effects?

SMO2 functions in regulating the progression of cell division during organ growth in Arabidopsis. The smo2 mutant exhibits a defect specifically in G2-M phase progression in the cell cycle . To measure the effects of SMO2 on cell division, researchers can employ several methodologies:

  • Cell cycle marker analysis: smo2 plants exhibit constitutive activation of cell cycle-related genes and over-accumulation of cells expressing CYCB1;1:β-glucuronidase (CYCB1;1:GUS) during organogenesis .

  • Cell counting techniques: Quantify the number of cells in specific organs to determine if disruption of SMO2 affects cell proliferation.

  • Growth rate measurement: Monitor the rate of cell production during leaf and root growth, as SMO2 disruption reduces this rate without altering developmental timing .

  • Flow cytometry: Analyze the cell cycle phase distribution, particularly focusing on G2-M transition defects.

How does SMO2 influence abscisic acid (ABA) response during seed germination?

SMO2 acts as a mediator of abscisic acid response during seed germination. This relationship can be quantified through several experimental approaches:

  • Germination assays on ABA-supplemented media: The table below summarizes key findings regarding SMO2's influence on ABA response based on research data:

GenotypeResponse to ABAGermination TimingCotyledon Greening (0.2 μM ABA)
Wild-typeNormal sensitivity16-24h post-stratification64%
smo2 knockoutHypersensitive20-48h post-stratification27%
SMO2-OE (overexpression)HyposensitiveSimilar to wild-type100%
  • Analysis of root growth on ABA-supplemented media to assess inhibition patterns.

  • Expression analysis of ABA-responsive genes in SMO2 mutant backgrounds.

The hypersensitivity of smo2 mutants to ABA during germination, contrasted with the hyposensitivity of SMO2 overexpression lines, strongly suggests that SMO2-regulated progression of cell division is involved in ABA response during this developmental stage .

What is the relationship between SMO2 function and sterol metabolism in Arabidopsis?

As a methylsterol monooxygenase, SMO2-2 (EC 1.14.13.72) plays a role in sterol biosynthesis, specifically in the removal of 4-alpha-methyl groups from sterol intermediates . To investigate the relationship between SMO2 function and sterol metabolism, researchers can:

  • Perform metabolic profiling using gas chromatography-mass spectrometry (GC-MS) to quantify sterol intermediates in wild-type versus smo2 mutants.

  • Conduct complementation studies with specific sterol intermediates to determine if supplementation rescues phenotypic defects.

  • Analyze gene expression patterns of other sterol biosynthesis enzymes in response to SMO2 disruption.

  • Investigate the cellular localization of SMO2 in relation to other sterol biosynthesis enzymes.

Understanding this relationship is crucial for connecting SMO2's roles in cell division and hormone response to fundamental metabolic pathways in plant development.

How can researchers investigate the molecular mechanism by which SMO2 affects G2-M phase progression?

Investigating the molecular mechanism linking SMO2 to G2-M phase progression requires sophisticated experimental approaches:

  • Phosphorylation analysis: Based on findings related to other proteins like VLG which are regulated by phosphorylation , researchers should examine whether SMO2 undergoes post-translational modifications that regulate its activity during cell cycle progression.

  • Protein-protein interaction studies: Use techniques such as co-immunoprecipitation, yeast two-hybrid assays, or bimolecular fluorescence complementation to identify cell cycle regulators that interact with SMO2.

  • Chromatin immunoprecipitation (ChIP): Determine if SMO2 interacts with chromatin or chromatin-modifying enzymes to influence cell cycle gene expression.

  • Live cell imaging: Use fluorescently tagged cell cycle markers in combination with labeled SMO2 to track their dynamic localization during cell division.

  • Inducible expression systems: Create cell line models with inducible SMO2 expression to capture immediate molecular changes associated with SMO2 activity.

These approaches can help elucidate whether SMO2's effect on cell cycle progression is direct (through interaction with cell cycle machinery) or indirect (through metabolic or hormonal changes).

What methodologies can be used to explore the functional homology between Arabidopsis SMO2 and yeast TRM112?

To explore the functional homology between Arabidopsis SMO2 and yeast TRM112, researchers can employ comparative and functional genomics approaches:

  • Complementation studies: Express Arabidopsis SMO2 in yeast TRM112 mutants to determine if it rescues phenotypic defects, and vice versa.

  • Structural analysis: Compare protein structures through computational modeling or crystallography to identify conserved domains.

  • Methylation assays: Since TRM112 is involved in tRNA and protein methylation , assess whether SMO2 exhibits similar methyltransferase activities.

  • Evolutionary analysis: Conduct phylogenetic studies to trace the evolutionary relationship between these proteins across different organisms.

  • Comparative transcriptomics: Analyze the impact of SMO2/TRM112 disruption on gene expression profiles in both organisms to identify conserved downstream effects.

This comparative approach can provide insights into evolutionarily conserved functions and potentially reveal novel aspects of SMO2 function based on knowledge of TRM112.

How do mutations in SMO2 affect cellular responses to plant hormones beyond ABA?

While SMO2's role in ABA response is documented, researchers interested in broader hormone interactions should explore:

  • Hormone sensitivity assays: Test growth responses of smo2 mutants to various plant hormones including auxins, gibberellins, cytokinins, brassinosteroids, and ethylene.

  • Gene expression analysis: Measure expression of hormone-responsive genes in smo2 backgrounds.

  • Double mutant analysis: Create and characterize double mutants between smo2 and known hormone signaling mutants.

  • Hormone quantification: Measure endogenous hormone levels in smo2 mutants to determine if SMO2 affects hormone biosynthesis.

This approach is particularly relevant given the connection between cell division, which SMO2 regulates, and various hormone signaling pathways. For example, connections might exist with brassinosteroid signaling, which regulates BRASSINOSTEROID INSENSITIVE2 (BIN2), a protein involved in developmental processes in Arabidopsis .

What are the most effective methods for analyzing SMO2 expression patterns in different tissues and developmental stages?

To effectively analyze SMO2 expression patterns, researchers should consider:

  • Quantitative RT-PCR: For precise quantification of SMO2 transcript levels across tissues and developmental stages.

  • In situ hybridization: To visualize spatial expression patterns within tissue sections.

  • Reporter gene fusions: Create SMO2 promoter:GUS or SMO2:GFP fusions to visualize expression patterns in vivo.

  • RNA-seq analysis: For genome-wide expression profiling in conjunction with SMO2 expression.

  • Immunolocalization: Using available antibodies to detect protein localization at cellular and subcellular levels.

When designing these experiments, researchers should consider that expression patterns may vary significantly during different developmental stages, particularly during seed germination and organ development where SMO2 function has been clearly demonstrated .

What approaches can be used to study the interplay between SMO2, cell division, and environmental stress responses?

To study the interplay between SMO2, cell division, and environmental stresses, researchers can:

  • Stress treatments combined with cell cycle analysis: Subject wild-type and smo2 plants to various stresses (drought, salt, temperature) and analyze cell cycle progression markers.

  • Transcriptomic analysis: Compare stress-responsive gene expression between wild-type and smo2 plants under various conditions.

  • Microscopy techniques: Use live-cell imaging to track cell division dynamics in response to stress in the presence/absence of functional SMO2.

  • Genetic approaches: Generate double mutants between smo2 and known stress response genes to identify genetic interactions.

This research direction is particularly promising given SMO2's established role in ABA response , a hormone central to many stress response pathways, suggesting that SMO2 may function at the intersection of cell division and environmental adaptation.

How can researchers differentiate between direct and indirect effects of SMO2 disruption in developmental phenotypes?

Differentiating between direct and indirect effects of SMO2 disruption requires sophisticated experimental designs:

  • Tissue-specific and inducible expression systems: Use tissue-specific or chemically inducible promoters to control SMO2 expression temporally and spatially.

  • Rapid induction experiments: Measure immediate molecular changes following SMO2 induction to identify direct targets.

  • ChIP-seq or DAP-seq: Identify DNA binding sites if SMO2 has DNA-binding capacity or associates with transcription factors.

  • Metabolomics approaches: Analyze changes in metabolite profiles, particularly sterols, to determine if metabolic alterations precede developmental phenotypes.

  • Single-cell analysis: Employ single-cell RNA-seq to identify cell-specific responses to SMO2 disruption.

This experimental framework helps distinguish primary molecular events directly linked to SMO2 function from secondary consequences that arise from developmental abnormalities.

How should researchers interpret apparent contradictions in SMO2 mutant phenotypes across different studies?

When encountering contradictory results regarding SMO2 function, researchers should systematically address several factors:

  • Genetic background differences: Different ecotypes of Arabidopsis may show varying phenotypic strengths in smo2 mutants.

  • Growth conditions: Standardize and carefully report light intensity, photoperiod, temperature, and growth media composition.

  • Allelic variation: Different smo2 alleles may produce distinct phenotypes based on the nature and position of mutations.

  • Functional redundancy: Consider the role of related genes (e.g., SMO2-1, SMO1) that might partially compensate for SMO2 loss.

  • Methodology differences: Note variations in experimental approaches, particularly in quantitative measurements.

A comprehensive table documenting growth conditions, genetic backgrounds, and methodologies across studies can help identify sources of variation and resolve apparent contradictions.

What are the considerations for designing complementation experiments to validate SMO2 function?

Proper complementation experiments for SMO2 should include:

  • Promoter selection: Use the native SMO2 promoter for physiologically relevant expression patterns, or tissue-specific promoters to address tissue-specific functions.

  • Protein tagging considerations: C-terminal and N-terminal tags may differentially affect protein function; test both or use untagged versions when possible.

  • Control transformations: Include empty vector controls and transformations into wild-type backgrounds to assess potential overexpression effects.

  • Multiple independent transgenic lines: Analyze at least 3-5 independent lines to account for position effects.

  • Quantification of rescue: Develop quantitative assays for key phenotypes (germination timing, root length, cell numbers) to measure the degree of complementation.

  • Protein level verification: Confirm expression of the transgene at the protein level using Western blot analysis with available antibodies .

These considerations ensure that observed phenotypic rescue can be confidently attributed to restoration of SMO2 function.

How can researchers analyze the relationship between SMO2 function and broader developmental networks in Arabidopsis?

To place SMO2 within broader developmental networks, researchers should:

  • Systems biology approaches: Use network analysis of transcriptomic, proteomic, and metabolomic data to position SMO2 in cellular pathways.

  • Multi-omics integration: Combine datasets from different molecular levels to build comprehensive models of SMO2 function.

  • Epistasis analysis: Generate double mutants between smo2 and other developmental regulators to establish genetic hierarchies.

  • Comparative analysis across plant species: Investigate SMO2 homologs in other plants to identify conserved developmental functions.

  • Temporal analysis: Track network changes across developmental stages to capture dynamic aspects of SMO2 function.

This comprehensive approach helps connect SMO2's role in cell division and hormone response to broader developmental programs in Arabidopsis, potentially revealing novel insights into plant growth regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.