Recombinant Arabidopsis thaliana Mitochondrial import inner membrane translocase subunit Tim17 (TIM17)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Protein Import

Tim17 is a core subunit of the TIM17:23 translocase complex, which facilitates the import of nuclear-encoded presequence-containing proteins into mitochondria:

  • Mechanism: Tim17 forms a lateral cavity in the inner mitochondrial membrane, utilizing conserved negative charges to guide presequence proteins .

  • Isoform Specificity: Arabidopsis has three Tim17 isoforms (Tim17-1, Tim17-2, Tim17-3). Recombinant Tim17-2 is essential for embryogenesis, while Tim17-1 regulates germination timing .

  • Energy Coupling: The translocase relies on the membrane potential (Δψ) and ATP-driven import motor (PAM complex) for precursor translocation .

Interactions with Respiratory Complexes

Recombinant Tim17-2 studies reveal dual localization in mitochondrial complexes:

  • TIM17:23 Translocase: Associates with Tim23-2 and Tim50 to form the protein import channel .

  • Respiratory Complex I: Binds to the B14.7 subunit, suggesting a regulatory link between protein import and oxidative phosphorylation .

Key Findings:

  • Knockout of Tim17-2 is embryonically lethal, underscoring its essential role .

  • Overexpression of Tim23-2 disrupts Complex I assembly, highlighting functional crosstalk .

Applications in Research

Recombinant Tim17 enables:

  • In Vitro Import Assays: Reconstituting TIM17:23 complexes to study translocation kinetics .

  • Mutational Analysis: Testing the impact of conserved residues (e.g., D17, D76) on presequence recognition .

  • Interaction Mapping: Identifying binding partners like Mgr2 and components of the PAM complex .

Regulatory and Biotechnological Relevance

  • Germination Control: Tim17-1 mutants exhibit accelerated germination due to altered ABA and gibberellin levels, linking mitochondrial biogenesis to developmental signaling .

  • Stress Adaptation: Tim17 isoforms are upregulated under UV light and oxidative stress, suggesting roles in stress resilience .

Challenges and Future Directions

  • Structural Resolution: Cryo-EM studies of recombinant Tim17 could clarify its channel architecture .

  • Isoform Redundancy: Functional overlap between Tim17 isoforms remains poorly understood .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
TIM17-2; At2g37410; F3G5.20; Mitochondrial import inner membrane translocase subunit TIM17-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TIM17-2
Target Protein Sequence
MGTPETSREPCPDRILDDIGGAFGMGAVGGSAFHFIKGTYNSPKGSRFVGGTQSVSMNAP RTGGSFAVWGGLFSTFDCTMVYLRQKEDPWNSIIAGAATGGFLSMRQGAGAASRSAIFGG VLLALIEGAGIMLNKVLAQPQNMMMEDPGMQGMPGMQGMQGMPGMPGMQGMPGMQGMQMG QMQSQAQIRSESQNQNTASSSSSSSWFGGLFDKKKEEVQPGSESKTEVLESFDAPPVPSF EFK
Uniprot No.

Target Background

Function
This protein is a crucial component of the TIM17:23 complex, which facilitates the translocation of proteins containing transit peptides across the mitochondrial inner membrane. It acts as a link between the inner and outer membranes.
Gene References Into Functions
  1. The C-terminal region of AtTIM17-2 is exposed on the outer surface of the outer mitochondrial membrane. This region plays a vital role in protein import into mitochondria. PMID: 15722347
Database Links

KEGG: ath:AT2G37410

STRING: 3702.AT2G37410.1

UniGene: At.11720

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Mitochondrion outer membrane. Note=The C-terminal region is located in the outer membrane.
Tissue Specificity
Expressed in roots, flowers, leaves and young cotyledons.

Q&A

What are the key structural differences between the three AtTim17 isoforms?

Arabidopsis thaliana possesses three Tim17 isoforms with distinct structural features. AtTim17-1 and AtTim17-2 contain C-terminal extensions (60 and 85 amino acids, respectively) not present in yeast or mammalian homologs, while AtTim17-3 is 25 amino acids shorter at the C-terminus . All three isoforms contain four predicted transmembrane domains, although in AtTim17-3, the fourth transmembrane region is positioned at the very end of the protein . These structural differences suggest functional specialization, with the C-terminal extensions of AtTim17-1 and AtTim17-2 potentially linking the outer and inner mitochondrial membranes, similar to yeast Tim23 .

How are the expression patterns of AtTim17 isoforms regulated during plant development?

The three AtTim17 isoforms exhibit distinctly different expression patterns throughout plant development. AtTim17-1 is primarily expressed in dry seeds and decreases during germination . AtTim17-2 is the most abundant isoform in most tissues and exhibits no significant change during germination . In contrast, AtTim17-3 increases in expression during germination . Analysis of the AtTim17-1 promoter revealed an abscisic acid (ABA)-responsive element that binds ABA-responsive transcription factors, acting to repress AtTim17-1 expression . These differential expression patterns indicate specialized roles for each isoform during plant development.

What is the functional significance of the lateral cavity in Tim17?

The Tim17 structure features a lateral cavity opening to the lipid bilayer, which is crucial for preprotein translocation. Mutations of hydrophilic residues within this cavity (N64L in TM2 and S114L in TM4) specifically impair the import of presequence proteins destined for the mitochondrial matrix without affecting proteins sorted to the inner membrane . Conserved negative charges close to the intermembrane space side of the bilayer are essential for initiating presequence protein import . This lateral cavity appears to be a conserved feature across the Tim17 protein family, including Tim22, suggesting a common mechanism for protein translocation through these translocases.

What are the recommended approaches for generating and characterizing AtTim17 knockout mutants?

For generating AtTim17 knockout mutants, T-DNA insertional lines have proven effective. Two independent T-DNA insertional mutant lines of tim17-1 exhibited viable phenotypes with germination-specific alterations . To characterize these mutants:

  • Confirm knockout status by RT-PCR and immunoblotting using isoform-specific antibodies

  • Assess protein abundance using immunodetection against isolated mitochondrial protein

  • Perform comprehensive phenotypic analyses, particularly focusing on developmental stages where the isoform is predominantly expressed

  • Conduct complementation studies using the native promoter to confirm phenotype rescue

  • Consider overexpression lines for functional analysis

For AtTim17-2, which is essential, conditional knockdown approaches may be necessary, as complete knockout results in embryo lethality .

How can recombinant AtTim17 proteins be effectively expressed and purified for structural and functional studies?

Successful expression and purification of recombinant AtTim17 proteins for structural and functional studies requires specific considerations:

  • Expression system selection: For functional studies, yeast expression systems have proven useful, especially for complementation assays. For structural studies, bacterial or insect cell systems may be preferable.

  • Construct design: Consider the following modifications:

    • Removal of the C-terminal extension for functional complementation in yeast

    • Addition of purification tags (2xStrep or HisSUMO tags have been used successfully)

    • Introduction of cysteine residues for crosslinking studies

  • Protein extraction and purification: Use detergent-based extraction methods optimized for membrane proteins, followed by affinity chromatography based on the chosen tag.

  • Functional reconstitution: For activity assays, reconstitution into liposomes or nanodiscs may be necessary to maintain the native conformation and activity of the protein.

What methods can be used to investigate protein-protein interactions involving AtTim17 in the mitochondrial import machinery?

Several complementary approaches have been successfully employed to investigate AtTim17 interactions:

  • Yeast two-hybrid assays: These have been used to identify interactions between Tim17-2 and other components of the import machinery, including Tim21, Tim21-like proteins, Tim23-2, and Tim50 .

  • Co-immunoprecipitation: Using tagged versions of Tim17 (such as Tim17-2xStrep) to pull down interacting partners .

  • Chemical crosslinking: Introducing cysteine residues at specific positions in Tim17 allows for site-specific crosslinking to identify proximity relationships with other proteins .

  • Blue Native PAGE: To analyze the intact TIM17:23 complex and its associations with other complexes.

  • Proteomics approaches: Mass spectrometry analysis of purified complexes to identify all interacting partners.

When interpreting interaction data, it's essential to consider the membrane environment and potential transient interactions that may occur during the dynamic process of protein import.

What is the specific role of AtTim17-1 in seed germination and how does it differ from the other isoforms?

AtTim17-1 plays a unique role in seed germination that distinguishes it from the other Tim17 isoforms:

  • Expression pattern: AtTim17-1 is predominantly expressed in dry seeds and decreases during germination, while AtTim17-2 shows consistent expression and AtTim17-3 increases during germination .

  • Germination phenotype: Knockout of AtTim17-1 results in accelerated germination rates, with two independent T-DNA insertional mutant lines showing significantly faster radicle emergence compared to wild-type plants .

  • Hormonal regulation: AtTim17-1 expression is repressed by abscisic acid (ABA) through an ABA-responsive element in its promoter. Mutant lines (Attim17-1) contained significantly increased levels of ABA and gibberellin (2-fold and 5-fold, respectively) in dry seeds .

  • Transcriptomic effects: Microarray analyses revealed that Attim17-1 mutants display alterations in the temporal sequence of transcriptomic events during germination, with gene expression changes peaking earlier compared to wild-type plants .

These findings suggest that AtTim17-1 functions as a negative regulator of germination, potentially coordinating mitochondrial biogenesis with seed germination timing through hormone-mediated pathways.

How does the presence of the C-terminal extension in AtTim17-1 and AtTim17-2 affect their function compared to AtTim17-3?

The C-terminal extensions present in AtTim17-1 and AtTim17-2 confer distinct functional properties:

  • Membrane topology: The C-terminus of imported AtTim17-2 is susceptible to degradation by externally added protease with intact mitochondria, suggesting it extends out of the inner membrane .

  • Membrane linkage: Removal of the 85 C-terminal amino acids from AtTim17-2 results in import and full protection of the truncated protein, indicating that the extension links the outer and inner membranes, similar to yeast Tim23 .

  • Yeast complementation: AtTim17-2 could only complement the yeast Tim17 deletion strain when the C-terminal extension was removed, suggesting functional incompatibility of this plant-specific feature in yeast .

  • Evolutionary conservation: The presence of C-terminal extensions in AtTim17-1 and AtTim17-2, but not in AtTim17-3 or yeast/mammalian homologs, suggests a plant-specific adaptation that may relate to unique aspects of plant mitochondrial biogenesis .

The C-terminal extension likely enables additional regulatory interactions or functional roles specific to plant mitochondria, possibly including connections between protein import and other mitochondrial processes such as respiration.

What experimental evidence supports the essential nature of AtTim17-2 versus the non-essential roles of AtTim17-1 and AtTim17-3?

The differential essentiality of AtTim17 isoforms is supported by multiple lines of evidence:

IsoformKnockout PhenotypeProtein AbundanceTissue ExpressionComplementation Ability
AtTim17-1Viable with accelerated germinationLow (detectable mainly in dry seeds)Seed-specificNot tested for essentiality
AtTim17-2Embryo lethalHighest abundance in most tissuesUbiquitousEssential for embryo development
AtTim17-3Not fully characterizedLower than AtTim17-2Low in seeds, increases during germinationNot tested for essentiality

AtTim17-2 has been established as the predominant isoform at the protein level when detected in mitochondria isolated from wild-type seedlings . The viability of AtTim17-1 knockout lines confirms it is a non-essential isoform, while AtTim17-2, being the predominant isoform, is essential for early embryo development . These findings suggest functional redundancy among the isoforms, with AtTim17-2 serving as the primary functional component of the TIM17:23 complex in most tissues.

How does AtTim17 interact with respiratory chain complexes and what are the implications for mitochondrial function?

AtTim17 has been shown to interact with respiratory chain complexes, suggesting coordination between protein import and respiratory function:

  • Complex I interactions: AtTim17-2 interacts with AtB14.7, a member of the PRAT family that is located in both respiratory complex I (NADH ubiquinone oxidoreductase) and the TIM17:23 complex .

  • Complex III interactions: Through Tim21, the TIM17:23 complex associates with Complex III components, including cytochrome c1, rieske iron-sulfur protein, and MPPα .

  • Functional consequences: Overexpression of subunits of TIM17:23 has been shown to result in a dramatic decrease in complex I abundance in Arabidopsis, suggesting regulatory crosstalk .

  • Tim21 as a mediator: AtTim21, which interacts with AtTim17-2, also interacts with subunits of respiratory complexes I and III, potentially serving as a bridge between protein import and respiratory function .

These interactions suggest a model for direct regulation of mitochondrial respiratory activity coordinated with mitochondrial biogenesis . The physical association between import machinery and respiratory complexes may facilitate the efficient assembly of imported respiratory subunits into their respective complexes.

What is known about the interaction between AtTim17 and AtTim23 in forming the functional TIM17:23 complex?

The interaction between AtTim17 and AtTim23 is central to forming the functional TIM17:23 complex:

  • Structural complementarity: While AtTim17 isoforms have varied C-terminal extensions, AtTim23 predicted proteins appear to lack the first 34 amino acids compared to yeast Tim23 . This suggests co-evolution of these proteins to form a functional complex.

  • Functional domains: For AtTim23, a preprotein and amino acid transporter (PRAT) domain must be present for complementation in yeast . In AtTim23-1 and AtTim23-2, the critical Arg in this domain is replaced by Thr, and changing this Thr to Arg enables complementation of yeast Tim23 .

  • Expression coordination: AtTim17-2, AtTim23-1, and AtTim23-2 show similar expression patterns, peaking at the earliest and latest stages of cotyledon development .

  • Complex formation: Both AtTim17 and AtTim23 integrate into the inner mitochondrial membrane in a membrane potential-dependent manner through internal signals .

The TIM17:23 complex in Arabidopsis appears to have evolved distinct structural features compared to yeast, potentially reflecting adaptation to plant-specific requirements for mitochondrial protein import during development and stress responses.

How do the three AtTim17 isoforms compare evolutionarily to Tim17 proteins in other plant species?

Evolutionary analysis of Tim17 isoforms reveals interesting patterns across plant species:

  • Multiple isoforms: While Arabidopsis possesses three Tim17 isoforms, other plant species similarly contain multiple isoforms, indicating that gene duplication and potential sub-functionalization occurred early in plant evolution .

  • Unique position of AtTim17-1: Notably, while multiple Tim17 isoforms exist across plant species, none other branch with AtTim17-1 in phylogenetic analyses, suggesting it may have evolved specialized functions in Arabidopsis .

  • Conservation of C-terminal extensions: The C-terminal extensions found in AtTim17-1 and AtTim17-2 appear to be plant-specific features, as they are not found in yeast or mammalian homologs .

  • Intron-less genes: All of the Arabidopsis TIM17 genes contain no introns, a feature shared only with TOM9 among mitochondrial import components .

This evolutionary divergence suggests that plants have developed specialized mechanisms for mitochondrial protein import, potentially relating to unique aspects of plant development, environmental responses, or metabolic requirements.

What methodological considerations are important when comparing recombinant AtTim17 function across different experimental systems?

When comparing recombinant AtTim17 function across different experimental systems, several methodological considerations are crucial:

  • Expression system compatibility: In yeast complementation studies, the C-terminal extension of AtTim17-2 had to be removed for functional complementation, indicating potential incompatibility between plant-specific features and heterologous systems .

  • Temperature sensitivity: Complementation of yeast Tim17 by AtTim17-2Δ143-243 showed better growth at 22°C compared to 30°C, suggesting temperature-dependent functionality that should be considered in experimental design .

  • Domain requirements: For complementation studies with AtTim23, a functional PRAT domain was essential, highlighting the importance of conserved functional domains across species .

  • Isoform-specific antibodies: Antibodies raised against specific AtTim17 isoforms may cross-react with other isoforms, necessitating careful design and validation of immunological tools .

  • Contextual function: A chimeric construct consisting of the first 50 amino acids of ScTim23 fused to AtTim23-2 failed to complement ScTim23 deletion, even with a PRAT domain, indicating that while functionally similar, plant and yeast proteins have distinct structural requirements .

These considerations highlight the importance of careful experimental design when studying recombinant AtTim17 function, particularly when using heterologous systems or making cross-species comparisons.

How can site-directed mutagenesis of conserved Tim17 residues be used to elucidate the mechanism of preprotein translocation?

Site-directed mutagenesis of conserved Tim17 residues provides valuable insights into the preprotein translocation mechanism:

  • Targeting the lateral cavity: Mutations of hydrophilic residues within the lateral cavity (N64L in TM2 and S114L in TM4) specifically impair the import of matrix-targeted preproteins without affecting inner membrane protein insertion . These residues are located on opposing sides of the cavity, suggesting a role in forming a translocation path.

  • Conserved negative charges: Tim17 contains conserved negative charges near the intermembrane space side of the bilayer that are essential for initiating presequence protein import . Mutating these negative charges (D17A, D76A) can help elucidate their role in recognizing positively charged presequences.

  • Cysteine scanning mutagenesis: Introducing cysteine residues at specific positions allows for crosslinking studies to identify proximity relationships with substrates and other translocase components .

  • Structure-guided mutations: Using structural models based on Tim22 cryo-EM structures as templates for rational mutagenesis of Tim17 can further elucidate the translocation mechanism .

This approach has revealed that Tim17 likely doesn't form a traditional channel for precursor translocation across the membrane, but rather provides a lateral cavity opening to the lipid bilayer similar to Tim22, challenging previous models of mitochondrial protein import .

What are the most promising approaches for studying the dynamic regulation of AtTim17 isoforms during plant stress responses?

Studying the dynamic regulation of AtTim17 isoforms during plant stress responses requires multifaceted approaches:

  • Promoter analysis: Analysis of AtTim17-1 promoter identified an ABA-responsive element, suggesting hormone-mediated regulation during stress . Similar analysis of other isoforms under various stress conditions could reveal regulatory mechanisms.

  • Stress-specific expression profiling: Quantitative real-time PCR and RNA-seq analysis across multiple stress conditions and timepoints can identify stress-specific regulation patterns for each isoform.

  • Stress-responsive phenotyping: Characterizing knockout and overexpression lines under various stresses (drought, salt, cold, heat, oxidative stress) can reveal condition-specific functions.

  • Post-translational modifications: Phosphoproteomics and other post-translational modification analyses during stress responses can identify regulatory mechanisms affecting Tim17 function.

  • Protein stability and turnover: Pulse-chase experiments or fluorescent timer fusion proteins can track changes in protein stability during stress conditions.

  • Stress-induced protein interactions: Proximity labeling techniques such as BioID or APEX2 can identify stress-induced changes in the Tim17 interactome.

These approaches would provide comprehensive insights into how AtTim17 isoforms are regulated during plant stress responses and their role in adaptive mitochondrial biogenesis during environmental challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.