Recombinant Arabidopsis thaliana MLO-like protein 10 (MLO10)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana MLO-like Protein 10 (MLO10)

Recombinant Arabidopsis thaliana MLO-like protein 10 (MLO10) is a protein derived from the model plant Arabidopsis thaliana. MLO proteins are part of a large family of proteins known for their roles in plant defense mechanisms and reproductive processes. Specifically, MLO10 has been identified as a key component in pollen-stigma recognition and pollen tube elongation during plant reproduction.

Biological Function of MLO10

MLO10 interacts with another protein, CML9 (Calcium/Calmodulin-like protein 9), to form a complex that plays a crucial role in pollen germination and pollen tube elongation. This interaction is essential for successful fertilization in plants. Studies using Arabidopsis thaliana have shown that mutations in either MLO10 or CML9 lead to reduced pollen germination rates and shorter pollen tubes, highlighting their importance in plant reproductive processes .

Expression and Localization

MLO10 is expressed in the stigma of Arabidopsis thaliana, while CML9 is expressed in pollen and pollen tubes. The interaction between these two proteins is believed to facilitate pollen-stigma recognition, which is a critical step in plant reproduction. The specific expression patterns suggest a maternal-paternal interaction model, where MLO10 in the stigma interacts with CML9 from the pollen .

Recombinant Production of MLO10

Recombinant MLO10 proteins can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells. These recombinant proteins are useful for studying the biochemical properties of MLO10 and its interactions with other proteins like CML9. For example, biotinylated versions of MLO10 can be produced using AviTag-BirA technology in E. coli .

Research Findings

Recent studies have focused on understanding the role of MLO10 in plant reproduction. Key findings include:

  • Pollen Germination and Tube Elongation: Mutations in MLO10 or CML9 significantly reduce pollen germination rates and pollen tube lengths, affecting seed setting .

  • Protein Interaction: The interaction between MLO10 and CML9 is specific and involves the C-terminal region of MLO10, particularly the P5 domain .

  • Reproductive Physiology: The MLO10-CML9 complex is crucial for pollen-stigma recognition and subsequent fertilization processes .

Table 1: Expression Systems for Recombinant MLO10

CodeSourceDescription
CSB-YP863793DOA1YeastRecombinant MLO10 protein
CSB-EP863793DOA1E. coliRecombinant MLO10 protein
CSB-EP863793DOA1-BE. coliBiotinylated recombinant MLO10 protein
CSB-BP863793DOA1BaculovirusRecombinant MLO10 protein
CSB-MP863793DOA1Mammalian cellRecombinant MLO10 protein

Table 2: Effects of MLO10 and CML9 Mutations on Pollen Germination and Tube Elongation

MutationPollen Germination Rate (%)Pollen Tube Length
Col-0 (Wild-type)75%Normal length
cml9-160%Shorter
cml9-260%Shorter

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirements when placing the order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
MLO10; At5g65970; K2A18.3; MLO-like protein 10; AtMlo10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-569
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO10
Target Protein Sequence
MATRCFWCWTTLLFCSQLLTGFARASSAGGAKEKGLSQTPTWAVALVCTFFILVSVLLEK ALHRVATWLWEKHKNSLLEALEKIKAELMILGFISLLLTFGEQYILKICIPEKAAASMLP CPAPSTHDQDKTHRRRLAAATTSSRCDEGHEPLIPATGLHQLHILLFFMAAFHILYSFIT MMLGRLKIRGWKKWEQETCSHDYEFSIDPSRFRLTHETSFVRQHSSFWTKIPFFFYAGCF LQQFFRSVGRTDYLTLRHGFIAAHLAPGRKFDFQKYIKRSLEDDFKVVVGISPLLWASFV IFLLLNVNGWEALFWASILPVLIILAVSTKLQAILTRMALGITERHAVVQGIPLVHGSDK YFWFNRPQLLLHLLHFALFQNAFQLTYFFWVWYSFGLKSCFHTDFKLVIVKLSLGVGALI LCSYITLPLYALVTQMGSNMKKAVFDEQMAKALKKWHMTVKKKKGKARKPPTETLGVSDT VSTSTSSFHASGATLLRSKTTGHSTASYMSNFEDQSMSDLEAEPLSPEPIEGHTLVRVGD QNTEIEYTGDISPGNQFSFVKNVPANDID
Uniprot No.

Target Background

Function
MLO10, a Recombinant Arabidopsis thaliana MLO-like protein 10, may play a role in regulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Database Links

KEGG: ath:AT5G65970

STRING: 3702.AT5G65970.1

UniGene: At.9206

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.