Recombinant Arabidopsis thaliana MLO-like protein 11 (MLO11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Arabidopsis thaliana MLO-Like Protein 11 (MLO11)

Recombinant Arabidopsis thaliana MLO-like protein 11 (MLO11) is a full-length, recombinant protein expressed in E. coli and tagged with an N-terminal histidine (His) tag for purification. It corresponds to the A. thaliana gene MLO11 (UniProt ID: Q9FI00), which encodes a plasma membrane-localized protein with seven transmembrane domains. MLO11 is implicated in plant developmental processes, including root thigmomorphogenesis and auxin-mediated signaling, and shares functional homology with barley MLO genes conferring disease resistance .

Role in Root Thigmomorphogenesis

MLO11, in conjunction with MLO4, regulates asymmetric root growth in response to tactile stimuli. Mutant mlo4 and mlo11 plants exhibit exaggerated root curling and aberrant waving patterns, which depend on auxin transport and signaling. Genetic epistasis experiments reveal that MLO4 and MLO11 function in a heterooligomeric complex to modulate thigmotropic responses .

Interaction with Calmodulin-Like Proteins (CMLs)

MLO11’s cytoplasmic C-terminal domain binds calcium-dependent calmodulin (CAM) via a conserved calmodulin-binding domain (CAMBD). Mutations in hydrophobic residues (e.g., L18, W21) within the CAMBD disrupt CAM binding, highlighting its role in calcium signaling .

Interaction AssayMLO11–CAM2 Binding
CAM overlay assay+++ (strong binding)
GST pull-down assay+++ (strong binding)
BiFC assay+++ (strong binding)

Disease Resistance and Functional Conservation

While A. thaliana MLO11 is not directly linked to disease resistance, its barley ortholog mlo-11 confers powdery mildew resistance via tandem repeat arrays that suppress Mlo gene transcription. Structural studies in A. thaliana reveal conserved membrane topology and CAM-binding motifs, suggesting evolutionary conservation of MLO protein function .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MLO11; At5g53760; MGN6.12; MLO-like protein 11; AtMlo11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-573
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO11
Target Protein Sequence
MGEGEENGNEADSNERSLALSPTWSVAIVLTVFVVVSLIVERSIYRLSTWLRKTKRKPMF AALEKMKEELMLLGFISLLLTATSSTIANICVPSSFYNDRFLPCTRSEIQEELESGSTVK RNLLTKSLFFNIFRRRLDVIKRTTCSEGHEPFVSYEGLEQLHRFIFIMAVTHVTYSCLTM LLAIVKIHSWRIWEDVARLDRHDCLTAVAREKIFRRQTTFVQYHTSAPLAKNRILIWVTC FFRQFGRSVDRSDYLTLRKGFIVNHHLTLKYDFHSYMIRSMEEEFQRIVGVSGPLWGFVV AFMLFNIKGSNLYFWIAIIPVTLVLLVGAKLQHVIATLALENAGLTEYPSGVKLRPRDEL FWFNKPELLLSLIHFILFQNSFELASFFWFWWQFGYSSCFLKNHYLVYFRLLLGFAGQFL CSYSTLPLYALVTQMGTNYKAALIPQRIRETIRGWGKATRRKRRHGLYGDDSTVRTETST IASLEEYDHQVLDVTETSFEQQRKQQEQGTTELELQPIQPRNDCVPNDTSSRVGTPLLRP WLSISSPTTTIELRSEPMETLSRSSSLPSEKRV
Uniprot No.

Target Background

Function
MLO11, a MLO-like protein in Arabidopsis thaliana, is potentially involved in regulating pathogen defense mechanisms and leaf cell death. Its activity appears to be regulated by calcium-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Gene References Into Functions
  1. mlo4/mlo11-conditioned root curling is independent of light and endogenous flavonoids but is pH-sensitive and influenced by exogenous calcium levels. PMID: 24738718
  2. Research indicates that the exaggerated root curling phenotypes observed in mlo4 and mlo11 mutants are dependent on auxin gradients, suggesting that MLO4 and MLO11 function as modulators of touch-induced root tropism. PMID: 19602625
Database Links

KEGG: ath:AT5G53760

STRING: 3702.AT5G53760.1

UniGene: At.6980

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO11 and what is its function in Arabidopsis thaliana?

MLO11 (MLO-like protein 11) is a membrane-localized protein encoded by the At5g53760 gene in Arabidopsis thaliana. It belongs to the MLO (Mildew Resistance Locus O) family of proteins, which are characterized by seven transmembrane domains and are primarily involved in plant defense responses and developmental processes. The protein consists of 573 amino acids and contains multiple transmembrane regions that anchor it to the plasma membrane .

The function of MLO11 involves modulation of defense responses, particularly against powdery mildew pathogens. Unlike some other MLO family members that have been extensively characterized, MLO11 has more specialized roles that may include:

  • Regulation of cellular responses to biotic stresses

  • Potential involvement in signal transduction pathways

  • Participation in developmental processes specific to certain tissue types

  • Possible roles in abiotic stress responses

For researchers beginning work with this protein, it's essential to understand that MLO11 functions within a complex network of plant immunity components and its specific role may vary depending on developmental stage and environmental conditions.

How should recombinant MLO11 be stored and handled for optimal stability?

Proper storage and handling of recombinant MLO11 is critical for maintaining protein integrity and experimental reproducibility. Based on established protocols for this protein:

  • Store lyophilized protein at -20°C to -80°C upon receipt

  • After reconstitution, store at -80°C for long-term storage

  • For working solutions, store aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly decrease protein activity

  • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0 for storage

For reconstitution:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Divide into small aliquots to minimize freeze-thaw cycles

Researchers should monitor protein stability through regular quality control checks, such as SDS-PAGE analysis, to ensure the protein maintains >90% purity over time.

What experimental approaches are most effective for studying MLO11 function in planta?

When investigating MLO11 function in planta, researchers should consider multiple complementary approaches:

  • Gene Knockout/Knockdown Studies:

    • CRISPR/Cas9-mediated gene editing to create null mutants

    • RNAi or artificial microRNA approaches for tissue-specific knockdown

    • T-DNA insertion lines (available from stock centers) with careful validation

  • Complementation and Overexpression Analysis:

    • Transformation with native promoter-driven constructs for complementation

    • Use of inducible promoters (e.g., estradiol, dexamethasone) for temporal control

    • Cell-type specific promoters for spatial expression studies

  • Protein Localization and Dynamics:

    • C-terminal or N-terminal fluorescent protein fusions (with careful validation)

    • FRET-based approaches for protein-protein interaction studies

    • Photoactivatable or photoconvertible tags for protein turnover studies

  • Pathogen Response Assays:

    • Controlled inoculation with powdery mildew pathogens

    • Quantification of disease progression in mutant vs. wild-type plants

    • Microscopic analysis of host-pathogen interfaces

A comprehensive experimental design should incorporate controls that address:

  • Genetic background effects

  • Position effects of transgene insertion

  • Potential pleiotropic effects of MLO11 manipulation

  • Environmental variables that might affect MLO11 function

How can researchers effectively purify active MLO11 for biochemical studies?

Purification of active MLO11 presents significant challenges due to its multiple transmembrane domains. A methodological approach should include:

  • Expression System Selection:

    • E. coli-based expression systems are commonly used but may result in inclusion bodies

    • Consider insect cell or yeast expression systems for improved folding

    • Cell-free systems may be advantageous for membrane proteins

  • Optimized Purification Protocol:

    • Metal affinity chromatography utilizing the His-tag

    • Detergent screening for optimal solubilization (e.g., DDM, LMNG, GDN)

    • Size exclusion chromatography for final polishing

  • Activity Preservation Strategies:

    • Maintain protein in nanodiscs or liposomes for functional studies

    • Include appropriate lipids to mimic native membrane environment

    • Optimize buffer conditions (pH, ionic strength, additives)

DetergentCMC (mM)Recommended ConcentrationAdvantagesLimitations
DDM0.171-2% for extraction, 0.05% for purificationMild, widely usedMay strip essential lipids
LMNG0.010.5-1% for extraction, 0.01% for purificationBetter stabilityExpensive, difficult to remove
Digitonin~0.51% for extraction, 0.1% for purificationVery mildNatural product variability

Quality control steps should include:

  • Functional assays to verify activity post-purification

  • Circular dichroism to assess secondary structure integrity

  • Thermal stability assays to optimize buffer conditions

What are the known interaction partners of MLO11 and how can these interactions be validated?

Understanding MLO11's interactome is crucial for elucidating its function. Current knowledge suggests several categories of interaction partners:

  • Calmodulin and Calcium-Signaling Components:
    MLO proteins typically interact with calmodulin in a calcium-dependent manner through their C-terminal domains

  • Cytoskeleton-Associated Proteins:
    Potential interactions with actin-binding proteins that may regulate vesicle trafficking or pathogen response

  • Other Membrane Proteins:
    Possible homo-oligomerization or hetero-oligomerization with other MLO family members

To validate these interactions, researchers should employ multiple complementary approaches:

  • In vivo approaches:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Co-immunoprecipitation from plant tissues

    • Proximity labeling (BioID or APEX2)

  • In vitro approaches:

    • Surface Plasmon Resonance (SPR) with purified components

    • Microscale Thermophoresis (MST)

    • Pull-down assays with recombinant proteins

    • Isothermal Titration Calorimetry (ITC) for quantitative binding parameters

When designing interaction studies, researchers should:

  • Include appropriate negative controls

  • Validate interactions using multiple methods

  • Consider the membrane environment when interpreting results

  • Assess the biological relevance of interactions through functional studies

How should researchers design experiments to study MLO11's role in disease resistance?

When investigating MLO11's role in disease resistance, careful experimental design is essential:

  • Hypothesis Formulation:
    Start with a clear, testable hypothesis about MLO11's function in disease resistance. For example: "MLO11 negatively regulates resistance to powdery mildew infection in Arabidopsis thaliana through modulation of cell wall-associated defense responses."

  • Variable Definition:

    • Independent variable: MLO11 expression levels or functional status

    • Dependent variable: Quantitative measures of disease resistance

    • Control variables: Growth conditions, pathogen inoculum, plant age

  • Experimental Groups:

    • Wild-type plants (positive control)

    • mlo11 knockout mutants

    • Complementation lines

    • MLO11 overexpression lines

  • Pathogen Challenge Protocols:
    Standardize inoculation procedures:

    • Use defined pathogen strains with known virulence

    • Control inoculum concentration (typically 10⁵-10⁶ spores/mL)

    • Maintain consistent inoculation methods (spraying vs. drop inoculation)

    • Include susceptible and resistant control plants

  • Quantitative Assessment Methods:

    • Macroscopic disease scoring on defined scales

    • Microscopic evaluation of fungal structures

    • Quantitative PCR for fungal biomass

    • Automated image analysis for objective quantification

  • Time Course Considerations:
    Evaluate disease progression at multiple time points:

    • Early (6-24 hours): Host recognition and initial response

    • Intermediate (2-3 days): Establishment of infection

    • Late (5-7 days): Full disease development

  • Molecular Response Analysis:

    • Transcriptomic analysis of defense-related genes

    • Proteomic analysis of immune responses

    • Metabolomic profiling of defense compounds

    • Histochemical detection of defense responses (callose, ROS)

This experimental design allows for comprehensive assessment of MLO11's role while controlling for confounding variables that might affect interpretation of results .

What controls are essential when working with recombinant MLO11 protein?

When conducting experiments with recombinant MLO11 protein, implementing appropriate controls is crucial for valid interpretation:

  • Protein Quality Controls:

    • Purity assessment via SDS-PAGE (>90% purity required)

    • Western blot confirmation of identity using anti-His and anti-MLO11 antibodies

    • Mass spectrometry verification of full-length protein

    • Lot-to-lot consistency checks for multi-experiment studies

  • Functional Controls:

    • Heat-denatured MLO11 as negative control

    • Known functional MLO family member as positive control

    • Empty vector-expressed product for expression system artifacts

    • Untagged protein version to control for tag interference

  • Buffer and Condition Controls:

    • Buffer-only controls in all assays

    • Detergent concentration matching in comparative studies

    • Temperature and pH stability checks

    • Time-dependent activity assessments

  • Interaction Study Controls:

    • Non-specific binding controls (e.g., irrelevant His-tagged protein)

    • Competition assays with unlabeled protein

    • Calcium-dependency controls (±EGTA)

    • Concentration-dependent effect validation

  • In vivo Expression Controls:

    • Empty vector transformants

    • Promoter-only constructs

    • Non-functional mutant versions (e.g., site-directed mutants)

    • Tissue-specific expression markers

Control TypePurposeImplementation
Negative ControlsEstablish baseline, detect false positivesBuffer-only, denatured protein, irrelevant protein
Positive ControlsValidate assay functionalityKnown MLO family member with established activity
Specificity ControlsConfirm observed effects are MLO11-specificCompetition assays, dose-response, mutant versions
System ControlsAccount for expression system artifactsEmpty vector products, untagged versions

How can researchers effectively compare MLO11 with other MLO family proteins in functional studies?

  • Sequence and Structure Comparison Framework:

    • Multiple sequence alignment to identify conserved and divergent regions

    • Homology modeling based on available MLO structures

    • Evolutionary analysis to establish relationships between family members

    • Domain-specific conservation analysis

  • Expression Pattern Analysis:

    • Tissue-specific expression profiling under identical conditions

    • Developmental stage comparisons using standardized growth conditions

    • Stress-responsive expression analysis with controlled stress application

    • Single-cell RNA-seq for cell-type specificity differences

  • Cross-Complementation Approaches:

    • Express MLO11
      under promoters of other MLO genes

    • Express other MLO genes under the MLO11 promoter

    • Create domain swap chimeras to identify functional regions

    • Assess phenotypic rescue in multiple mlo mutant backgrounds

  • Standardized Phenotypic Assays:

    • Identical pathogen challenge protocols across all MLO variants

    • Consistent developmental phenotyping methods

    • Standardized abiotic stress response assessment

    • Equivalent protein interaction screening methods

  • Biochemical Property Comparisons:

    • Side-by-side purification under identical conditions

    • Equivalent tagging strategies for all family members

    • Parallel stability assessments

    • Identical buffer and storage conditions

When designing comparative studies, researchers should:

  • Use proteins expressed and purified under identical conditions

  • Implement consistent methodological approaches across all family members

  • Control for expression level differences when interpreting functional differences

  • Consider evolutionary distance when selecting family members for comparison

What are the main challenges in expressing and purifying functional MLO11?

Researchers working with MLO11 face several technical challenges due to its nature as a multi-pass membrane protein:

  • Expression Challenges:

    • Poor expression levels in bacterial systems due to membrane localization

    • Protein misfolding leading to inclusion body formation

    • Toxicity to host cells when overexpressed

    • Improper post-translational modifications in heterologous systems

  • Solubilization Difficulties:

    • Incomplete extraction from membranes

    • Protein aggregation during detergent solubilization

    • Loss of structural integrity in detergent micelles

    • Detergent interference with downstream applications

  • Purification Obstacles:

    • Low yields after multi-step purification

    • Copurification of lipids and interacting proteins

    • Tag accessibility issues due to membrane domains

    • Protein heterogeneity in final preparations

Methodological solutions include:

ChallengeSolution ApproachMethodological Details
Poor expressionExpression system optimizationUse specialized E. coli strains (C41/C43, Rosetta), lower induction temperature (16-18°C), reduce IPTG concentration (0.1-0.2 mM)
Inclusion bodiesRefolding strategiesGradual dialysis with decreasing denaturant, pulse refolding, artificial chaperone-assisted refolding
Membrane extractionDetergent screeningSystematic testing of detergent panels (ionic, non-ionic, zwitterionic) at varying concentrations
Structural integrityStabilization approachesNanodiscs incorporation, addition of cholesterol or specific lipids, ligand stabilization if known
Low yieldsPurification optimizationTandem affinity tags, on-column detergent exchange, reducing purification steps

Additional considerations:

  • E. coli codon optimization may improve expression levels

  • Fusion partners (MBP, SUMO) can enhance solubility

  • Baculovirus expression systems may provide better folding environments

  • Cell-free systems allow direct incorporation into liposomes

How can researchers address the challenge of studying MLO11 protein-protein interactions in membrane environments?

Studying MLO11 interactions presents unique challenges due to its membrane localization. Effective strategies include:

  • Membrane-Compatible Interaction Assays:

    • Split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins

    • MYTH (Membrane Yeast Two-Hybrid) system with bait proteins fused to a split-ubiquitin moiety

    • mSPINE (membrane-based Single Protein Interaction Engineering) approach

  • Advanced Microscopy Approaches:

    • Single-molecule tracking to observe dynamic interactions in living cells

    • FRET-FLIM for quantitative measurement of protein proximities

    • Super-resolution microscopy (PALM/STORM) for nanoscale interaction mapping

    • Light sheet microscopy for rapid 3D imaging with reduced photodamage

  • Biochemical Strategies:

    • Crosslinking-mass spectrometry (XL-MS) with membrane-permeable crosslinkers

    • Proximity labeling methods (BioID, APEX) that work in membrane environments

    • Co-immunoprecipitation with specialized detergent mixtures

    • Label-transfer approaches for transient interactions

  • Reconstituted Systems:

    • Proteoliposome reconstitution with controlled lipid composition

    • Nanodiscs containing MLO11 with potential interacting partners

    • Supported lipid bilayers with incorporated proteins

    • Droplet interface bilayers for electrical measurements

Methodological recommendations:

  • Begin with in vivo approaches to identify candidates under physiological conditions

  • Validate with multiple, complementary techniques

  • Control for non-specific hydrophobic interactions common with membrane proteins

  • Consider the lipid environment's impact on interaction dynamics

  • Use quantitative approaches where possible to determine binding parameters

What are the best approaches for analyzing MLO11 phosphorylation and other post-translational modifications?

Post-translational modifications (PTMs) of MLO11, particularly phosphorylation, are likely important regulatory mechanisms. Comprehensive analysis requires:

  • Identification Strategies:

    • Phosphoproteomics using TiO₂ or IMAC enrichment

    • Site-specific phospho-antibodies for known sites

    • Phos-tag SDS-PAGE for mobility shift detection

    • Mass spectrometry with electron transfer dissociation (ETD) or electron capture dissociation (ECD)

  • Functional Analysis Methods:

    • Site-directed mutagenesis (Ser/Thr/Tyr to Ala) to prevent phosphorylation

    • Phosphomimetic mutations (Ser/Thr/Tyr to Asp/Glu) to simulate constitutive phosphorylation

    • Temporal analysis during pathogen infection or stress responses

    • Identification of responsible kinases using inhibitor approaches

  • PTM Crosstalk Assessment:

    • Analysis of interplay between phosphorylation and other modifications

    • Sequential immunoprecipitation to identify multiply-modified species

    • Combinatorial mutagenesis to assess modification interdependence

    • Targeted proteomics for specific PTM combinations

  • Structural Impact Evaluation:

    • Molecular dynamics simulations to predict effects on protein conformation

    • Hydrogen-deuterium exchange mass spectrometry before and after modification

    • Interaction studies with phosphorylated vs. non-phosphorylated protein

    • Stability and activity assays comparing modified and unmodified states

Predicted phosphorylation sites in MLO11 include several conserved residues in the C-terminal cytoplasmic domain, which may serve as regulatory switches for protein interactions or activity. Researchers should focus on these regions initially while also conducting unbiased whole-protein analyses.

When designing PTM studies, consider:

  • The dynamic nature of phosphorylation events

  • The stoichiometry of modification (often sub-stoichiometric)

  • The need for phosphatase inhibitors during protein extraction

  • The potential for artifactual modifications during sample processing

How should researchers analyze transcriptomic data related to MLO11 function?

Analyzing transcriptomic data for MLO11 functional studies requires systematic approaches:

  • Experimental Design Considerations:

    • Include appropriate biological replicates (minimum n=3)

    • Consider time course experiments to capture dynamic responses

    • Include both mlo11 knockout and overexpression lines

    • Design tissue-specific or cell-type-specific analyses where relevant

  • Differential Expression Analysis Framework:

    • Use established statistical packages (DESeq2, edgeR, limma)

    • Apply appropriate normalization methods

    • Set biologically meaningful significance thresholds (adjusted p-value <0.05 and |log₂FC| >1)

    • Validate key findings with qRT-PCR

  • Functional Annotation Approaches:

    • Gene Ontology (GO) enrichment analysis

    • MapMan or KEGG pathway mapping

    • Protein-protein interaction network construction

    • Promoter motif analysis for co-regulated genes

  • Comparative Analysis Strategies:

    • Compare with other mlo family mutant transcriptomes

    • Analyze overlap with known pathogen response datasets

    • Integrate with proteomics or metabolomics data

    • Compare with public stress response datasets

  • Advanced Analytical Methods:

    • Co-expression network analysis to identify functional modules

    • Bayesian network inference for causal relationship prediction

    • Machine learning approaches for complex pattern recognition

    • Systems biology modeling of identified pathways

When interpreting transcriptomic data:

  • Focus on biological processes rather than individual genes

  • Consider the temporal dynamics of gene expression changes

  • Be aware of potential compensatory mechanisms in mutants

  • Integrate findings with existing knowledge about MLO functions

  • Validate key findings using independent experimental approaches

What statistical approaches are most appropriate for analyzing MLO11 phenotypic data?

  • Experimental Design Statistical Considerations:

    • Power analysis to determine sample size (typically n≥10 for plant phenotyping)

    • Randomized complete block design to control environmental variables

    • Factorial designs for multi-factor experiments (e.g., genotype × treatment)

    • Split-plot designs for experiments with different measurement scales

  • Data Distribution Assessment:

    • Test for normality using Shapiro-Wilk or Kolmogorov-Smirnov tests

    • Assess homogeneity of variances with Levene's or Bartlett's tests

    • Consider transformations for non-normal data (log, square root, etc.)

    • Use appropriate non-parametric alternatives when assumptions are violated

  • Comparison Methods by Data Type:

Data TypeParametric MethodsNon-parametric Alternatives
Continuous (normal)t-test, ANOVA, ANCOVAMann-Whitney U, Kruskal-Wallis
CategoricalChi-square, logistic regressionFisher's exact test
Time-to-eventSurvival analysisLog-rank test
Repeated measuresRM-ANOVA, mixed modelsFriedman test
  • Advanced Statistical Approaches:

    • Linear mixed-effects models for nested data structures

    • Multivariate analysis for correlated response variables

    • Generalized additive models for non-linear relationships

    • Bayesian approaches for small sample sizes or complex designs

  • Multiple Testing Correction:

    • Bonferroni correction for conservative control of family-wise error rate

    • Benjamini-Hochberg procedure for false discovery rate control

    • Sequential Bonferroni for balanced approach

    • Simulation-based corrections for complex dependency structures

When analyzing phenotypic data:

  • Report effect sizes alongside p-values

  • Use appropriate visualizations (box plots, violin plots) that show data distribution

  • Consider biological significance beyond statistical significance

  • Be transparent about data transformations and outlier handling

  • Validate findings across multiple experiments or conditions

How can researchers integrate multiple data types when studying MLO11 function?

Integrating diverse data types provides a comprehensive understanding of MLO11 function:

  • Multi-omics Integration Strategies:

    • Sequential analysis pipeline (analyze each data type separately then integrate)

    • Simultaneous analysis (joint dimension reduction or clustering)

    • Network-based integration (construct networks from each data type and analyze overlaps)

    • Bayesian integration (probabilistic models incorporating multiple data types)

  • Data Types and Integration Approaches:

Data Type CombinationIntegration MethodsTools/Platforms
Transcriptomics + ProteomicsCorrelation analysis, Pathway mappingGSEA, IPA, MetaboAnalyst
Genetics + PhenomicsQTL mapping, GWASR/qtl, TASSEL, PLINK
Protein-protein interactions + ExpressionNetwork analysis, Enrichment analysisCytoscape, STRING, GeneMANIA
Metabolomics + TranscriptomicsPathway analysis, Metabolite-gene correlationsMetScape, Paintomics
  • Temporal and Spatial Integration:

    • Time-series analysis across multiple data types

    • Tissue-specific or cell-type-specific multi-omics

    • Developmental stage comparisons with multiple measurements

    • Stress response dynamics across platforms

  • Computational Integration Methods:

    • Machine learning approaches (random forests, neural networks)

    • Matrix factorization methods (NMF, PCA, tensor decomposition)

    • Graph-based data fusion

    • Canonical correlation analysis for paired datasets

  • Validation and Interpretation Strategies:

    • Hypothesis generation from integrated data

    • Targeted experimental validation of key predictions

    • Iterative refinement of models based on new data

    • Biological context consideration when interpreting results

Best practices for multi-data integration:

  • Standardize data processing across platforms

  • Account for different noise characteristics of each data type

  • Consider appropriate data transformation before integration

  • Use visualization tools designed for multi-omics data

  • Validate findings using independent experimental approaches

  • Focus on convergent evidence across multiple data types

What are the emerging research directions for MLO11 studies?

The field of MLO11 research continues to evolve, with several promising directions:

  • Systems Biology Approaches:

    • Network-based analysis of MLO11 in the context of plant immunity

    • Quantitative models of MLO11 regulation and function

    • Multi-scale approaches connecting molecular mechanisms to whole-plant phenotypes

    • Comparative systems analysis across different plant species

  • Advanced Technological Applications:

    • CRISPR base editing for precise modification of regulatory sites

    • Single-cell transcriptomics to understand cell-type specific functions

    • Cryo-EM structural studies of MLO11 alone and in complexes

    • Optogenetic tools for temporal control of MLO11 function

  • Translational Research Directions:

    • Engineering of MLO11 variants with enhanced or novel functions

    • Exploration of MLO11 orthologs in crop species for disease resistance

    • Development of small molecule modulators of MLO11 function

    • Biotechnological applications based on MLO11 properties

  • Fundamental Biological Questions:

    • Role of MLO11 in non-host resistance mechanisms

    • Evolutionary history and functional diversification of MLO family

    • Integration of MLO11 function with broader cellular signaling networks

    • Potential roles beyond pathogen defense

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.