Recombinant Arabidopsis thaliana MLO-like protein 12 (MLO12)

Shipped with Ice Packs
In Stock

Description

Characteristics of Recombinant MLO12 Protein

The recombinant MLO12 protein is produced in Escherichia coli (E. coli) and is available as a full-length protein with 576 amino acids, tagged with a His-tag for easy purification . The protein is provided in a lyophilized form and has a purity of greater than 90% as determined by SDS-PAGE. It is stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 and should be kept at -20°C or -80°C to maintain stability .

Research Findings on MLO12

Research on the mlo2 mlo6 mlo12 triple mutant has shown that these plants exhibit complete immunity against powdery mildew fungi like Golovinomyces orontii. This immunity is attributed to the disruption of the defense suppression mechanism typically mediated by MLO proteins . The mlo2 mlo6 mlo12 mutants also display altered interactions with other pathogens, such as reduced host cell entry by Colletotrichum higginsianum, a fungus that directly penetrates leaf epidermal cells similar to powdery mildew .

Moreover, studies have indicated that MLO proteins play a role in enabling defense suppression during the invasion by adapted powdery mildew fungi. The mlo2 mlo6 mlo12 triple mutant overcomes the need for specific defense-related compounds and pathways, suggesting a broad activation of immune responses .

Applications and Future Directions

The recombinant MLO12 protein can be used in various biochemical and biotechnological applications, including the study of plant-pathogen interactions and the development of novel resistance strategies against powdery mildew. Understanding how MLO proteins interact with other plant defense components can provide insights into improving crop resistance.

Furthermore, the use of Arabidopsis thaliana as a model organism for recombinant protein production offers advantages in terms of genetic manipulation and expression systems . This could facilitate the large-scale production of MLO12 and other proteins for research and agricultural applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MLO12; At2g39200; T16B24.16; MLO-like protein 12; AtMlo12; AtMlo18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-576
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO12
Target Protein Sequence
MAIKERSLEETPTWAVAVVCFVLLFISIMIEYFLHFIGHWFKKKHKKALSEALEKVKAEL MLLGFISLLLVVLQTPVSEICIPRNIAATWHPCSNHQEIAKYGKDYIDDGRKILEDFDSN DFYSPRRNLATKGYDKCAEKGKVALVSAYGIHQLHIFIFVLAVFHVLYCIITYALGKTKM KKWKSWERETKTIEYQYANDPERFRFARDTSFGRRHLNIWSKSTFTLWITCFFRQFFGSV TKVDYLTLRHGFIMAHLPAGSAARFDFQKYIERSLEQDFTVVVGISPLIWCIAVLFILTN THGWDSYLWLPFLPLIVILIVGAKLQMIISKLGLRIQEKGDVVKGAPVVEPGDDLFWFGR PRFILFLIHLVLFTNAFQLAFFVWSTYEFTLKNCFHHKTEDIAIRITMGVLIQVLCSYIT LPLYALVTQMGTSMRPTIFNDRVANALKKWHHTAKKQTKHGHSGSNTPHSSRPTTPTHGM SPVHLLHNYNNRSLDQQTSFTASPSPPRFSDYSGQGHGHQHFFDPESQNHSYQREITDSE FSNSHHPQVDMASPVREEKEIVEHVKVDLSEFTFKK
Uniprot No.

Target Background

Function
This protein may be involved in the modulation of pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Database Links

KEGG: ath:AT2G39200

STRING: 3702.AT2G39200.1

UniGene: At.12809

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO12 and what is its role in Arabidopsis thaliana?

MLO12 is one of the MLO-like proteins in Arabidopsis thaliana that functions as a co-ortholog of barley Mlo. It is involved in modulating plant susceptibility to powdery mildew disease, though it plays a secondary role compared to MLO2, which is the main contributor to powdery mildew susceptibility . The MLO12 protein consists of 576 amino acids and contains transmembrane domains similar to other MLO proteins . In its wild-type form, MLO12 contributes to susceptibility to powdery mildew infection, while loss-of-function mutations can contribute to disease resistance .

What is the structure and topology of MLO12?

MLO12 shares structural similarities with other MLO proteins, including a predicted membrane topology with transmembrane domains. While detailed structural information specific to MLO12 is limited in the provided search results, related MLO proteins like MLO2 have an in silico determined membrane topology comprising seven transmembrane domains, an extracellular/luminal N-terminus, and a cytoplasmic C-terminus . Based on the amino acid sequence, the full-length MLO12 protein (1-576aa) likely adopts a similar conformation with regions that interact with calmodulin and potentially other regulatory proteins . The carboxyl-terminal region of MLO proteins is particularly important for function and protein-protein interactions.

How is recombinant Arabidopsis thaliana MLO12 protein produced?

Recombinant full-length Arabidopsis thaliana MLO-like protein 12 can be expressed in E. coli with an N-terminal His tag . The production process typically involves:

  • Cloning the MLO12 gene sequence into an expression vector

  • Transforming the vector into E. coli cells

  • Inducing protein expression under appropriate conditions

  • Purifying the protein using affinity chromatography (leveraging the His tag)

  • Confirming protein purity using SDS-PAGE (>90% purity)

  • Lyophilizing the purified protein into powder form for storage and distribution

The recombinant protein represents the full-length sequence (amino acids 1-576) of the native protein and is typically stored in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What are the recommended storage and handling conditions for recombinant MLO12?

For optimal stability and activity of recombinant MLO12 protein, follow these research-validated handling protocols:

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Additives5-50% glycerol (final concentration) for long-term stability
HandlingBrief centrifugation prior to opening; avoid repeated freeze-thaw cycles

Repeated freezing and thawing should be avoided as it may compromise protein integrity and activity . For researchers conducting extended studies, creating multiple single-use aliquots upon initial reconstitution is strongly recommended to maintain consistent experimental conditions.

How does MLO12 interact with calmodulin and what methodologies can assess this interaction?

MLO12, like other MLO proteins, likely interacts with calmodulin (CAM) through a calmodulin-binding domain (CAMBD). While the search results focus primarily on MLO2's interaction with CAM2, similar methodologies can be applied to study MLO12-calmodulin interactions. Based on research with related MLO proteins, seven different types of protein-protein interaction assays can be employed:

  • In vitro CAM overlay assay: Using recombinant MLO12 CT (carboxyl terminus) fused to GST and hexahistidine-tagged calmodulin to detect direct binding

  • Yeast two-hybrid (Y2H) system: Though less effective for MLO2, this could be optimized for MLO12 interactions

  • Yeast split-ubiquitin system: Particularly the Ura3-based variant which has proven effective for membrane protein interactions

  • In planta protein-protein interaction approaches: These would test MLO12-calmodulin interactions in a native cellular environment

Research indicates that key hydrophobic amino acids in the CAMBD are crucial for the MLO-CAM association. Site-directed mutagenesis targeting conserved residues within the predicted CAMBD of MLO12 (analogous to the LW/RR mutation in MLO2) could provide insight into the specific amino acids required for calmodulin binding .

What are the functional differences between MLO12 and other MLO co-orthologs (MLO2, MLO6) in Arabidopsis thaliana?

MLO12 functions in conjunction with MLO2 and MLO6 in modulating powdery mildew susceptibility, but with distinct contributions to the phenotype. Research has established a hierarchy of functional importance:

  • MLO2: The primary contributor to powdery mildew susceptibility; single mlo2 mutants show partial resistance

  • MLO6 and MLO12: Secondary contributors that enhance resistance when mutated in combination with mlo2; the triple mutant mlo2 mlo6 mlo12 exhibits the strongest resistance phenotype

These functional differences may relate to:

  • Differential expression patterns across tissues

  • Varying protein-protein interaction profiles

  • Distinct regulatory mechanisms

  • Potentially different subcellular localizations

To investigate these differences experimentally, researchers should consider comparative studies including:

  • Expression analysis across tissues and developmental stages

  • Protein localization studies using fluorescent tags

  • Interactome analysis to identify unique binding partners

  • Complementation assays to test functional redundancy

How can site-directed mutagenesis of MLO12 be designed to study critical functional domains?

Site-directed mutagenesis of MLO12 can elucidate structure-function relationships by targeting conserved amino acid residues. Based on comparative studies with MLO2 and barley Mlo, the following approach is recommended:

  • Target selection: Identify conserved residues between MLO12 and other MLO proteins, particularly in the CAMBD and other functionally important regions

  • Mutation design: Consider the following mutation types:

    • Substitution of hydrophobic residues with charged amino acids (e.g., leucine/tryptophan to arginine as in the LW/RR mutation strategy)

    • Conservative vs. non-conservative substitutions to assess the importance of specific amino acid properties

    • Alanine scanning of putative functional domains

  • Validation methods:

    • Protein-protein interaction assays to test effects on calmodulin binding

    • Functional complementation in mlo12 mutant plants

    • Localization studies to ensure proper membrane topology is maintained

A systematic mutagenesis approach comparing wild-type and mutant variants will help identify residues critical for MLO12 function in powdery mildew susceptibility pathways.

What methods can be used to analyze MLO12 protein structure and disorder prediction?

Analysis of MLO12 protein structure can be approached using both computational and experimental methods. Building on approaches used for MLO2, researchers should consider:

Computational methods:

  • AlphaFold prediction: Generate three-dimensional structural models, with particular focus on the cytoplasmic C-terminus of MLO12

  • PONDR-FIT analysis: Apply this meta-predictor to identify intrinsically disordered regions in MLO12, which may be important for protein-protein interactions

  • Comparative modeling: Leverage structural information from related MLO proteins to predict MLO12 structure

Experimental methods:

  • Circular dichroism spectroscopy: Determine secondary structure elements within recombinant MLO12 protein

  • Limited proteolysis: Identify stable domains and flexible regions

  • Hydrogen-deuterium exchange mass spectrometry: Map structurally dynamic regions within the protein

Based on MLO2 analysis, researchers should pay particular attention to the predicted α-helical region within the CAMBD and potentially intrinsically disordered regions in the C-terminus, which may be crucial for protein function and interactions .

What experimental systems can be used to study MLO12 function in disease resistance?

Several experimental systems are appropriate for studying MLO12 function in powdery mildew resistance:

  • Genetic approaches:

    • Analysis of single, double, and triple mutant combinations of mlo2, mlo6, and mlo12

    • Complementation assays with wild-type and mutant MLO12 variants

    • CRISPR/Cas9-mediated genome editing to generate novel mutant alleles

  • Pathogen challenge assays:

    • Quantitative assessment of powdery mildew susceptibility in plants with altered MLO12 expression

    • Microscopic analysis of fungal development stages

    • Time-course studies of infection progression

  • Heterologous expression systems:

    • Expression of MLO12 in barley mlo mutants to test functional conservation

    • Yeast-based assays to study specific protein functions outside the plant context

  • Biochemical approaches:

    • Co-immunoprecipitation to identify MLO12 interacting partners in planta

    • Liposome reconstitution systems to study membrane protein function

Each system offers distinct advantages for addressing specific aspects of MLO12 biology and disease resistance mechanisms.

How can recombinant MLO12 protein be optimized for structural studies?

Optimizing recombinant MLO12 protein production for structural studies requires addressing several challenges inherent to membrane proteins:

  • Expression system selection:

    • E. coli: Suitable for cytoplasmic domains like MLO12 CT

    • Insect cells: Better for full-length membrane proteins with post-translational modifications

    • Cell-free systems: Useful for toxic or unstable proteins

  • Construct design:

    • Domain-based approach focusing on soluble regions (e.g., C-terminus)

    • Fusion partners to enhance solubility (MBP, SUMO, etc.)

    • Deletion of flexible regions that may impede crystallization

  • Purification optimization:

    ParameterOptimization Strategy
    Buffer compositionScreening various buffers, pH values, and ionic strengths
    Detergent selectionTesting different detergents for membrane domain solubilization
    Protein concentrationConcentration methods that minimize aggregation
    Sample homogeneitySize exclusion chromatography as final purification step
  • Stability assessment:

    • Thermal shift assays to identify stabilizing conditions

    • Limited proteolysis to identify stable domains

    • Dynamic light scattering to monitor aggregation propensity

For crystallography specifically, surface entropy reduction (replacing high-entropy residues with alanines) may improve crystallization prospects, while for cryo-EM studies, ensuring sample homogeneity and appropriate particle size distribution is critical.

What are the most effective protein-protein interaction assays for studying MLO12 associations in planta?

Based on comparative assessment of protein-protein interaction methods used for MLO2, the following techniques are recommended for studying MLO12 interactions in planta:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Allows visualization of protein interactions in their native cellular context

    • Can reveal the subcellular localization of interactions

    • Requires careful design of fusion proteins and appropriate controls

  • Co-immunoprecipitation (Co-IP):

    • Enables detection of native protein complexes

    • Can be combined with mass spectrometry for unbiased identification of interacting partners

    • Requires optimization of extraction conditions for membrane proteins

  • Förster Resonance Energy Transfer (FRET):

    • Provides quantitative measurement of protein proximity

    • Suitable for dynamic interaction studies

    • Requires careful selection of fluorophore pairs and controls

  • Proximity-dependent biotin identification (BioID):

    • Allows identification of proximal proteins in living cells

    • Useful for detecting transient or weak interactions

    • Provides information about the spatial environment of MLO12

Each method offers distinct advantages and limitations, and a multi-method approach is recommended to comprehensively characterize MLO12 interaction networks.

How can transcriptional regulation of MLO12 be studied in response to pathogen challenge?

Understanding MLO12 regulation during pathogen infection requires multiple complementary approaches:

  • Quantitative gene expression analysis:

    • RT-qPCR for targeted analysis of MLO12 expression kinetics

    • RNA-seq for genome-wide transcriptional changes during infection

    • Comparison of expression patterns between MLO12 and other MLO genes

  • Promoter analysis:

    • Identification of cis-regulatory elements in the MLO12 promoter

    • Reporter gene constructs (e.g., MLO12pro:GUS) to visualize expression patterns

    • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the MLO12 promoter

  • Epigenetic regulation:

    • DNA methylation analysis of the MLO12 locus

    • Chromatin accessibility studies (ATAC-seq)

    • Histone modification profiling at the MLO12 locus before and after pathogen challenge

  • Single-cell approaches:

    • Single-cell RNA-seq to capture cell-type-specific responses

    • In situ hybridization to visualize MLO12 expression in specific tissues

These approaches will help elucidate the regulatory mechanisms controlling MLO12 expression during powdery mildew infection and potentially identify targets for enhancing disease resistance.

What are common challenges in expressing and purifying recombinant MLO12, and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant MLO12 protein:

  • Low expression levels:

    • Optimize codon usage for the expression host

    • Test different promoters and expression conditions

    • Consider fusion tags that enhance expression (such as MBP or SUMO)

    • Evaluate alternative expression systems (insect cells, yeast)

  • Protein insolubility:

    • Express only soluble domains (e.g., C-terminal domain) instead of full-length protein

    • Optimize lysis buffer composition and detergent selection

    • Lower induction temperature (16-20°C)

    • Co-express with molecular chaperones

  • Purification difficulties:

    ChallengeSolution
    Poor binding to affinity resinEnsure tag accessibility; adjust imidazole concentration
    Contaminant proteinsInclude additional purification steps (ion exchange, size exclusion)
    Protein degradationAdd protease inhibitors; reduce purification time; maintain cold temperature
    Protein aggregationInclude stabilizing agents (glycerol, specific salts); optimize pH
  • Protein instability after purification:

    • Store at -80°C in small aliquots to avoid freeze-thaw cycles

    • Add stabilizers such as glycerol (5-50%)

    • Optimize buffer composition based on thermal shift assays

    • For long-term storage, consider lyophilization in the presence of stabilizing excipients

By systematically addressing these challenges, researchers can improve the yield and quality of recombinant MLO12 protein for functional and structural studies.

How can inconsistent results in MLO12 functional studies be reconciled?

When faced with inconsistent results in MLO12 functional studies, consider the following methodological approaches:

  • Experimental system variations:

    • Different Arabidopsis ecotypes may show varying MLO12 functions

    • Growth conditions affect powdery mildew susceptibility

    • Pathogen isolates vary in virulence and host interaction patterns

  • Genetic redundancy considerations:

    • Functional overlap between MLO2, MLO6, and MLO12 may mask phenotypes

    • Higher-order mutants may be required to observe clear phenotypes

    • Residual expression in knockdown lines can lead to variable results

  • Technical validation steps:

    • Confirm mutant/transgenic lines by genotyping and expression analysis

    • Use multiple independent transgenic lines

    • Include appropriate positive and negative controls

    • Quantify phenotypes with standardized, objective measurements

  • Reconciliation strategies:

    • Meta-analysis of published studies with attention to methodological differences

    • Collaborative cross-laboratory validation studies

    • Standardization of experimental protocols and reporting

The hierarchical and potentially redundant functions of MLO proteins necessitate careful experimental design and interpretation, particularly when studying the secondary player MLO12 whose phenotypic effects may be subtle compared to MLO2 .

What are promising research avenues for translating MLO12 knowledge to crop improvement?

Translating fundamental knowledge of MLO12 to crop improvement offers several promising research directions:

  • Targeted breeding and engineering:

    • Identification of natural mlo12 alleles in crop germplasm

    • Development of CRISPR/Cas9 genome editing strategies for MLO12 orthologs in crops

    • Combining mutations in multiple MLO genes for enhanced resistance

  • Functional conservation studies:

    • Comparative analysis of MLO12 function across diverse crop species

    • Identification of conserved domains that could be targeted across species

    • Evaluation of fitness costs associated with mlo mutations in different crops

  • Pathway engineering approaches:

    • Identification of MLO12-regulated defense pathways that could be alternatively modulated

    • Development of strategies to conditionally regulate MLO12 expression

    • Creation of chimeric MLO proteins with modified regulatory properties

  • Resistance durability assessment:

    • Long-term field studies of mlo-based resistance

    • Investigation of pathogen adaptations to mlo resistance

    • Combination with other resistance mechanisms for enhanced durability

The exceptional durability of mlo-based resistance in barley suggests that similar approaches targeting MLO12 and related proteins in other crops could provide sustainable disease control solutions .

How might advanced protein structural biology techniques contribute to understanding MLO12 function?

Emerging structural biology techniques offer new opportunities to understand MLO12 function:

  • Cryo-electron microscopy (Cryo-EM):

    • Structure determination of full-length MLO12 in membrane environments

    • Visualization of MLO12 in complex with interacting partners

    • Structural changes upon calcium/calmodulin binding

  • Integrative structural biology:

    • Combining X-ray crystallography of soluble domains with Cryo-EM of full-length protein

    • Complementing experimental data with computational modeling

    • Cross-validation with biophysical techniques (SAXS, NMR, mass spectrometry)

  • Dynamic structural techniques:

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Single-molecule FRET to capture dynamic structural transitions

    • Time-resolved structural studies to capture transient states

  • In-cell structural biology:

    • Visualization of MLO12 structure in its native cellular environment

    • Correlative light and electron microscopy to connect structure with function

    • In-cell NMR to study protein dynamics in living cells

Building upon the AlphaFold predictions and disorder analysis approaches used for MLO2 , these advanced techniques could reveal how MLO12 structure relates to its function in disease susceptibility and resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.