Recombinant Arabidopsis thaliana MLO-like protein 14 (MLO14)

Shipped with Ice Packs
In Stock

Description

MLO14 in the Context of the MLO Family

The MLO family comprises plant-specific seven-transmembrane domain proteins involved in diverse physiological processes. MLO14 belongs to a clade with MLO4 and MLO11, which regulate root thigmomorphogenesis (touch-induced growth responses) . Key features include:

  • Phylogenetic clade: MLO4, MLO11, and MLO14 form a distinct evolutionary subgroup .

  • Functional redundancy: Mutant studies suggest overlapping roles for these proteins in root growth modulation .

  • Structural domains: MLO proteins contain conserved calcium-binding motifs (e.g., CAMBD), critical for interactions with calmodulin .

Recombinant MLO14 Production Strategies

While no published protocols explicitly describe MLO14 recombinant production, established Arabidopsis platforms provide a roadmap:

Table 1: Recombinant Protein Production Systems in Arabidopsis

SystemYieldApplicationsKey Features
Super-expression0.4 mg/g FWMembrane complexes (e.g., oligosaccharyltransferase)Enables assembly of multi-subunit complexes; suitable for structural studies .
E. coli expressionVariableSoluble enzymes, tags (e.g., His-tag)Cost-effective but limited for membrane proteins like MLO14 .
Transient expressionHigh (μg/mg FW)Antibodies, vaccinesRequires glycoengineering for functional glycoproteins .

Considerations for MLO14:

  • Membrane protein challenges: MLO14’s seven-transmembrane topology complicates solubility. Detergent-based purification or fusion tags (e.g., GFP) may enhance stability .

  • Host selection: Arabidopsis systems may outperform E. coli for native folding and post-translational modifications .

Functional Insights from MLO Paralogs

MLO14’s role remains less characterized than its clade members, but parallels exist:

Table 2: Functional Roles of MLO4/MLO11/MLO14 Clade

ProteinMutant PhenotypeMechanismKey Regulators
MLO4Anisotropic root curlingAlters auxin transport dynamicsGβ subunit, PIN2/EIR1 transporters .
MLO11Enhanced root skewing/wavingModulates touch-induced asymmetryLight- and nutrient-dependent .
MLO14Undefined (phenotype not reported)Likely co-functional with MLO4/MLO11Hypothesized calcium signaling .

Research Gaps and Future Directions

  1. Structural characterization: No resolved structures exist for MLO14. Homology modeling using barley MLO CAMBD domains could identify calcium-binding residues .

  2. Interaction networks: MLO proteins often partner with calmodulin or G-proteins. Yeast two-hybrid screens or co-immunoprecipitation assays could map MLO14 interactors .

  3. Biotechnological applications: Engineering MLO14 variants (e.g., CAMBD mutants) may elucidate its role in stress responses or development .

References to Methodological Frameworks

  • Purification protocols: SDS-PAGE and MALDI-TOF validation, as used for Arabidopsis AOX1A , ensure recombinant protein integrity.

  • Activity assays: Calcium-dependent binding assays (e.g., surface plasmon resonance) could test MLO14-CAM interactions .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us. We will prioritize development of the specified tag if possible.
Synonyms
MLO14; At1g26700; T24P13.8; MLO-like protein 14; AtMlo14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-554
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO14
Target Protein Sequence
MREETEPSERTLGLTPTWSVATVLTIFVFVSLIVERSIHRLSNWLQKTKRKPLFAALEKM KEELMLLGFISLLLTATSSTIANICVSSSFHNDRFVPCTPSEINEELESTISTVKRTQLT RSLFLHTLRRRLSGIGEDTCSEGHEPFLSYEGMEQLHRFIFIMAVTHVTYSCLTMLLAIV KIHRWRIWEDEVHMDRNDCLTVVAREKIFRRQTTFVQYHTSAPLVKNRLLIWVICFFRQF GHSVVRSDYLTLRKGFIMNHHLTLTYDFHSYMIRSMEEEFQKIVGVSGPLWGFVVGFMLF NIKGSNLYFWLAIIPITLVLLVGAKLQHVIATLALENASITEYASGIKLRPRDELFWFKK PELLLSLIHFIQFQNAFELASFFWFWWQFGYNSCFLRNHLLVYLRLILGFSGQFLCSYST LPLYALVTQMGTNYKAALLPQRVRETINGWGKATRRKRRHGLYGDDSTIRTETSTIASVD EYNDQVLDVSETSPVQDNELELQLIRGACGNSSSVETPILRPCASISSTTFSRLQTETTD SLSRSSSLPMRREC
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana MLO-like protein 14 (MLO14) may play a role in regulating pathogen defense and leaf cell death. Its activity appears to be modulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Database Links

KEGG: ath:AT1G26700

STRING: 3702.AT1G26700.1

UniGene: At.19092

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO14 and how is it classified within the MLO protein family?

MLO14 (MILDEW RESISTANCE LOCUS O 14) is a seven-transmembrane domain protein belonging to the MLO family in Arabidopsis thaliana. This family consists of 15 members that are phylogenetically divided into distinct clades, with MLO14 specifically positioned in clade I alongside MLO4 and MLO11 . The gene encoding MLO14 is located at locus At1g26700 on chromosome 1 of the Arabidopsis genome . Structurally, MLO14 is characterized as an integral membrane protein with seven transmembrane domains, which is a defining feature of the MLO family . This protein family is specific to plants and homologous to the barley mildew resistance locus o (MLO) protein, with various members playing roles in disease resistance and plant development .

What is the molecular structure and sequence characteristics of MLO14?

MLO14 is a protein consisting of 554 amino acids with a full amino acid sequence available in protein databases . The protein contains several key structural elements characteristic of MLO proteins, including seven transmembrane domains and potential regulatory regions . Research on related MLO proteins has shown the importance of a calmodulin-binding domain (CAMBD) with key hydrophobic amino acid residues that are essential for calcium-dependent binding of calmodulin . The protein has specific hydrophobic and hydrophilic regions that enable its proper integration into the plasma membrane, with both the N-terminal and C-terminal domains playing important roles in protein function .

What is the expression pattern of MLO14 in Arabidopsis thaliana?

MLO14 exhibits a specific and localized expression pattern in Arabidopsis thaliana. According to GUS activity pattern studies, MLO14 is expressed during early seedling growth, particularly in developing primary roots and prominently in root tips of 10-day old seedlings . Notably, expression was not detected in leaves or flowers, indicating a root-specific function . This expression pattern parallels that of its clade members MLO4 and MLO11, suggesting potential functional relationships among these closely related genes . The overlapping expression patterns of these phylogenetically related genes may indicate functional redundancy, co-function, or possibly antagonistic functions in regulating root development .

What are the proposed functions of MLO14 based on its phylogenetic relationships?

Based on phylogenetic analysis and studies of related proteins, MLO14's function appears to be connected to root development and responses to environmental stimuli. As a member of clade I along with MLO4 and MLO11, MLO14 is likely involved in root thigmomorphogenesis - the change in growth patterns in response to mechanical stimuli . Studies on MLO4 and MLO11 have demonstrated that mutations in these genes result in exaggerated root curling when grown on hard surfaces, with subtle differences in their phenotypes suggesting complementary rather than redundant functions .

Research with mlo4 mlo11 mlo14 triple mutants showed no additional reduction in root span or further exaggeration of aberrant root waving patterns compared to mlo4 mlo11 double mutants, suggesting that these proteins work in the same pathway rather than having additive effects . The connection between MLO4/MLO11 and auxin transport suggests that MLO14 may similarly influence root development through modulation of auxin signaling or transport mechanisms .

What methods are most effective for studying MLO14 function in planta?

Multiple complementary approaches are necessary for comprehensive characterization of MLO14 function:

  • Genetic Approaches:

    • T-DNA insertion mutants such as mlo14-6 and mlo14-7 provide valuable loss-of-function resources for phenotypic analysis

    • Creation of higher-order mutants (e.g., mlo4 mlo11 mlo14) to address functional redundancy within the clade

    • CRISPR/Cas9-mediated gene editing for generating precise mutations or domain modifications

  • Expression Analysis:

    • RT-PCR and qRT-PCR to quantify and validate transcript levels in different tissues and conditions

    • Promoter-reporter constructs to visualize spatial and temporal expression patterns

    • RNA-seq for genome-wide expression analysis comparing wild-type vs. mutant backgrounds

  • Protein Localization and Interaction Studies:

    • Fluorescent protein fusions (e.g., MLO14-GFP) for subcellular localization

    • Analysis of PIN-GFP markers in mlo14 backgrounds to examine effects on auxin transport machinery

    • Co-immunoprecipitation to identify protein interaction partners

  • Phenotypic Analysis:

    • Root growth assays under various conditions (vertical vs. horizontal growth, different media compositions)

    • Response to mechanical stimuli and gravitropic challenges

    • Microscopic analysis of root cell morphology and development

How should recombinant MLO14 protein be handled for experimental studies?

When working with recombinant MLO14 protein, several important considerations must be addressed:

The recombinant protein should be stored in a Tris-based buffer with 50% glycerol at -20°C, or at -80°C for extended storage periods . Researchers should avoid repeated freezing and thawing cycles as this can significantly reduce protein activity . For short-term work, aliquots may be stored at 4°C for up to one week .

For expression studies, researchers have successfully used various expression systems, with the tag type being determined during the production process based on research objectives . When designing functional assays, it's important to consider that MLO14 is an integral membrane protein, which presents challenges for traditional biochemical approaches. Detergent selection for solubilization is critical and should be optimized based on downstream applications.

How does the function of MLO14 in disease resistance compare to other MLO family members?

The MLO family in Arabidopsis has diverse roles in pathogen interactions, with different clades showing distinct functions:

MLO2, MLO6, and MLO12 (belonging to a different clade than MLO14) have well-established roles in powdery mildew susceptibility, where their loss-of-function mutations lead to resistance against powdery mildew pathogens . The mlo2 mlo6 mlo12 triple mutant exhibits complete resistance to adapted powdery mildew fungi, representing one of the most effective forms of resistance against this disease .

In contrast, the specific role of MLO14 in pathogen resistance remains less characterized. While belonging to clade I with MLO4 and MLO11, which are primarily implicated in root development rather than pathogen responses, the potential involvement of MLO14 in disease resistance requires further investigation .

Research has shown that the mlo2 mlo6 mlo12 triple mutant exhibits altered responses to other pathogens including Fusarium oxysporum, Colletotrichum higginsianum, and Pseudomonas syringae . This suggests that MLO proteins may have broader roles in plant-microbe interactions beyond powdery mildew resistance. Similar comprehensive infection assays with mlo14 mutants would be valuable to determine whether MLO14 influences responses to different pathogen classes.

What experimental approaches can differentiate the disease resistance functions of different MLO family members?

To properly characterize and differentiate the disease resistance functions of MLO14 compared to other family members, the following methodological approaches are recommended:

  • Parallel Infection Assays: Challenge single mlo14 mutants, other single mlo mutants, and various mutant combinations with diverse pathogens including:

    • Powdery mildew fungi (e.g., Golovinomyces cichoracearum)

    • Bacterial pathogens (e.g., Pseudomonas syringae)

    • Fungal pathogens (e.g., Fusarium oxysporum, Colletotrichum higginsianum)

    • Oomycetes (e.g., Hyaloperonospora arabidopsidis, Albugo spp.)

  • Quantitative Assessment Methods:

    • Measure infection rates through microscopic analysis of pathogen structures

    • Quantify pathogen biomass using qPCR with pathogen-specific primers

    • Assess disease symptoms through standardized scoring systems

    • Compare sporulation levels for reproductive success of pathogens

  • Defense Response Analysis:

    • Monitor reactive oxygen species production during infection

    • Assess callose deposition at infection sites

    • Examine expression of defense marker genes

    • Analyze phytohormone accumulation (salicylic acid, jasmonic acid)

How can domain swapping experiments between MLO family members reveal functional regions of MLO14?

Domain swapping experiments represent a powerful approach to identifying functional regions within MLO14. Based on studies with related MLO proteins, researchers should consider the following methodological strategy:

  • Critical Domain Identification:

    • The C-terminal domain of MLO4 has been shown to be necessary but not sufficient for its function in root thigmomorphogenesis

    • Chimeric constructs swapping the C-terminal domain of MLO14 with that of other MLO proteins (e.g., MLO2, MLO4) can reveal its functional significance

    • Sequential domain swapping (transmembrane domains, loops, N-terminus) can identify other regions critical for MLO14 function

  • Complementation Analysis:

    • Express chimeric proteins in mlo14 mutant backgrounds

    • Quantitatively assess the degree of phenotypic rescue for each construct

    • Compare root development parameters and potential pathogen response phenotypes

  • Protein Interaction Mapping:

    • Identify domains required for interaction with calmodulin and other binding partners

    • Test whether domain-swapped variants maintain proper subcellular localization

    • Assess whether specific domains determine functional specificity versus redundancy

What genomic prediction approaches are most suitable for studying MLO14 function across Arabidopsis accessions?

For investigating MLO14 function and its natural variation across different Arabidopsis accessions, several genomic prediction methods have demonstrated varying effectiveness:

MethodStrengthsBest Application for MLO14 Research
Linear Models (gBLUP)Good baseline performance, widely usedInitial assessment of MLO14 natural variation
Neural NetworksHighest accuracy for traits with high heritabilityComplex MLO14-related phenotypes with potential epistatic interactions
Random ForestsCaptures non-linear relationshipsIdentifying accessions with unique MLO14 functions
Support Vector MachinesGood for high-dimensional dataWhen studying MLO14 with limited phenotypic data

Recent research in Arabidopsis genomic prediction has shown that neural networks often outperform linear models for traits with high heritability, while the latter remain competitive for simpler traits . When studying MLO14 across accessions, a nested cross-validation approach is recommended to determine the optimal prediction method for specific MLO14-related phenotypes .

The 1001 Arabidopsis Genomes Project provides an extensive resource of genotypic data that can be leveraged for such studies, with dense SNP data available across all five chromosomes . When combined with phenotypic data from resources like AraPheno, researchers can develop robust predictive models for MLO14 function across diverse genetic backgrounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.