Recombinant Arabidopsis thaliana MLO-like protein 2 (MLO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana MLO-like Protein 2 (MLO2)

Recombinant Arabidopsis thaliana MLO-like protein 2 (MLO2) is a heptahelical integral membrane protein critical for plant-pathogen interactions, particularly in modulating susceptibility to powdery mildew. Native MLO2 is encoded by the At1g11310 gene and spans 573 amino acids, with a cytosolic carboxyl-terminal domain (CT) containing a calmodulin-binding domain (CAMBD) essential for calcium-dependent interactions with calmodulin (CAM) isoforms like CAM2 . The recombinant version is typically expressed in E. coli as a His-tagged fusion protein (e.g., N-terminal His6-tag) for structural and functional studies .

Domain Architecture

MLO2 features:

  • Seven transmembrane domains (TMDs) anchoring the protein to the plasma membrane.

  • Cytosolic C-terminal region (amino acids 439–573), containing an α-helical CAMBD (residues 451–468) that forms an amphiphilic helix. This region is intrinsically disordered except for the CAMBD, as predicted by AlphaFold and PONDR-FIT analyses .

  • Extracellular N-terminal region (luminal domain).

Helical Wheel Projection of CAMBD
The CAMBD exhibits a conserved amphipathic α-helix, with hydrophobic residues (e.g., L18, W21) on one face and hydrophilic residues on the opposite face. This structure facilitates calcium-dependent binding to CAM .

Protein Interaction Studies

MLO2 interacts with CAM2 via its CAMBD, a process critical for modulating powdery mildew susceptibility. Mutagenesis experiments highlight key residues:

Assay TypeWild-Type MLO2 BindingLW/RR Mutant BindingKey Residues
CAM Overlay AssayStrong interactionReduced bindingL18, W21 (hydrophobic)
BiFC (BiFC)Confirmed interactionReduced fluorescenceL18, W21, H31
Yeast Two-Hybrid (Y2H)No interactionNo interactionNot detected
Split-Ubiquitin (Ura3)No interactionNo interactionNot detected
FRET and Co-IPConfirmed interactionReduced bindingL18, W21, K26, K30

Key Findings:

  • The LW/RR mutant (substituting L18R and W21R) abolished CAM2 binding in most assays, confirming the role of hydrophobic residues in the CAMBD .

  • Basic residues (K26, K30) and H31 (a conserved histidine) also contribute to CAM binding, though less critically than L18/W21 .

  • Y2H and split-ubiquitin systems failed to detect interaction, possibly due to technical limitations with membrane proteins .

Physiological Roles and Genetic Significance

MLO2 functions as a susceptibility factor for powdery mildew, with loss-of-function mutants conferring broad-spectrum resistance . Beyond pathogen response, MLO2 is implicated in:

  • Leaf senescence: Timely regulation of senescence onset .

  • Reactive oxygen species (ROS) sensitivity: Modulation of extracellular ROS responses .

  • Systemic acquired resistance (SAR): Potential role in priming defense pathways .

Genetic Context:

  • MLO2 is one of three A. thaliana co-orthologs of barley Mlo (others: MLO6, MLO12), with MLO2 being the primary susceptibility determinant .

  • Paralogs like MLO4, MLO7, and MLO11 govern distinct processes (e.g., root thigmomorphogenesis, pollen tube guidance) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on multiple factors including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MLO2; At1g11310; T28P6.4; MLO-like protein 2; AtMlo2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-573
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO2
Target Protein Sequence
MADQVKERTLEETSTWAVAVVCFVLLFISIVLEHSIHKIGTWFKKKHKQALFEALEKVKA ELMLLGFISLLLTIGQTPISNICISQKVASTMHPCSAAEEAKKYGKKDAGKKDDGDGDKP GRRLLLELAESYIHRRSLATKGYDKCAEKGKVAFVSAYGIHQLHIFIFVLAVVHVVYCIV TYAFGKIKMRTWKSWEEETKTIEYQYSNDPERFRFARDTSFGRRHLNFWSKTRVTLWIVC FFRQFFGSVTKVDYLALRHGFIMAHFAPGNESRFDFRKYIQRSLEKDFKTVVEISPVIWF VAVLFLLTNSYGLRSYLWLPFIPLVVILIVGTKLEVIITKLGLRIQEKGDVVRGAPVVQP GDDLFWFGKPRFILFLIHLVLFTNAFQLAFFAWSTYEFNLNNCFHESTADVVIRLVVGAV VQILCSYVTLPLYALVTQMGSKMKPTVFNDRVATALKKWHHTAKNETKHGRHSGSNTPFS SRPTTPTHGSSPIHLLHNFNNRSVENYPSSPSPRYSGHGHHEHQFWDPESQHQEAETSTH HSLAHESSEPVLASVELPPIRTSKSLRDFSFKK
Uniprot No.

Target Background

Function
MLO2 may play a role in the modulation of pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Gene References Into Functions
  1. The findings overall are inconsistent with a role of MLO2 as a canonical G-protein coupled receptors (GPCR). PMID: 23656333
  2. We validate MLO2 as an interactor and novel virulence target of the P. syringae type III secreted effector HopZ2. PMID: 22230763
  3. mlo2-mediated pathogen resistance depends on the biosynthesis of indolic secondary metabolites. PMID: 20023151
Database Links

KEGG: ath:AT1G11310

STRING: 3702.AT1G11310.1

UniGene: At.24513

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of Arabidopsis thaliana MLO2?

MLO2 is a seven-transmembrane domain protein localized in the plasma membrane. It belongs to clade IV of the MLO protein family in Arabidopsis thaliana, along with MLO3, MLO6, and MLO12. The full-length protein consists of 573 amino acids with a functionally significant carboxyl terminus that contains a calmodulin-binding domain (CAMBD) . The protein's transmembrane topology is critical for its function, with both the N-terminus and C-terminus domains playing distinct roles in protein-protein interactions and signaling cascades involved in plant immunity .

What are the expression patterns of MLO2 in Arabidopsis?

MLO2 shows tissue-specific expression patterns throughout Arabidopsis development. The gene is expressed during early seedling growth, in roots, in the vascular system of cotyledons and young leaves, and in fruit abscission zones. Notably, MLO2 expression is absent in anthers and pollen, as demonstrated by GUS activity patterns . MLO2 expression is induced after inoculation with bacterial pathogens like Pseudomonas syringae and is promoted by salicylic acid (SA) signaling . Additionally, MLO2 expression is systemically enhanced in plant foliage exhibiting systemic acquired resistance (SAR) .

How can recombinant MLO2 protein be effectively produced for functional studies?

Recombinant MLO2 protein can be produced using bacterial expression systems such as E. coli. For optimal results, the full-length protein (1-573aa) can be fused to an N-terminal His tag for purification purposes . When designing expression constructs, researchers should consider that:

  • The full-length protein contains multiple transmembrane domains that may affect solubility

  • Alternative approaches include expressing only the carboxyl terminus (MLO2CT) containing the CAMBD for interaction studies

  • Site-directed mutagenesis can be employed to create specific amino acid substitutions (e.g., LW/RR mutant) to study the functional significance of particular domains

For protein-protein interaction studies, multiple complementary approaches should be used, including in vitro and in vivo methods, to ensure robust results .

What methods are most effective for studying MLO2 protein-protein interactions?

Multiple complementary approaches should be employed to validate MLO2 interactions, as evidenced by studies of MLO2-CAM2 binding. The following methods have proven effective:

MethodApplicationAdvantagesLimitations
Yeast split-ubiquitin systemFull-length protein interactionsAllows study of membrane proteinsMay have false positives
Bimolecular fluorescence complementation (BiFC)In planta visualizationDirect visualization in plant cellsMay force weak interactions
In vitro binding assaysBiochemical confirmationDirect measurement of bindingLacks cellular context
Co-immunoprecipitationEndogenous interactionsTests native protein complexesRequires specific antibodies

Research has shown that while the classical yeast two-hybrid approach was ineffective for MLO2 studies, other methods successfully demonstrated MLO2-CAM2 interaction, highlighting the importance of method selection .

How does MLO2 function in susceptibility to powdery mildew pathogens?

MLO2 acts as a susceptibility factor for powdery mildew infection in Arabidopsis. Loss-of-function mutations in MLO2 confer resistance to powdery mildew fungi by restricting fungal penetration at the cell wall . This resistance mechanism appears to involve an accelerated non-host resistance (NHR) response that becomes effective even against adapted pathogens .

The resistance phenotype follows a hierarchy of genetic redundancy: the strongest susceptibility defect is caused by mutation of MLO2 alone, while mutations in MLO6 and MLO12 have no detectable effect individually. Double mutant combinations of mlo2 with mlo6 or mlo12 gradually increase resistance beyond the mlo2 single mutant level, and the triple mutant (mlo2 mlo6 mlo12) exhibits complete penetration resistance to powdery mildew fungi .

What is the contradictory role of MLO2 in bacterial versus fungal pathogen responses?

MLO2 presents an intriguing dichotomy in pathogen responses:

  • For powdery mildew fungi: MLO2 functions as a susceptibility factor, with mlo2 mutations conferring resistance .

  • For bacterial pathogens (Pseudomonas syringae): MLO2 is necessary for systemic acquired resistance (SAR), with mlo2 mutants unable to systemically increase resistance to bacterial infection .

This contradiction highlights a complex evolutionary balance in plant-pathogen interactions. While MLO2 appears disadvantageous in powdery mildew interactions, its critical role in SAR against bacterial pathogens suggests evolutionary pressure to maintain functional MLO proteins. The mechanistic explanation involves:

  • Basal resistance to bacterial infection is not affected in mlo2 mutants, only SAR

  • MLO2 acts downstream of SAR signal generation (SA and pipecolic acid)

  • MLO2 is essential for translating elevated defense responses into disease resistance during SAR

How does the calmodulin-binding domain (CAMBD) of MLO2 function?

The CAMBD of MLO2 is located in the C-terminal region and mediates calcium-dependent interaction with calmodulin (CAM) proteins, particularly CAM2 in Arabidopsis . Key hydrophobic amino acid residues within the CAMBD are critical for establishing the MLO-CAM interaction. Site-directed mutagenesis studies have shown that substitution of these essential residues with positively charged arginines (particularly the LW/RR mutant) largely prevents calcium-dependent binding of CAM to the CAMBD .

The functional significance of this interaction has been demonstrated in barley, where mutations in the CAMBD lower the susceptibility-conferring capacity of the MLO protein to powdery mildew, suggesting that calcium signaling through calmodulin binding is important for MLO function . Similar molecular mechanisms appear to operate in Arabidopsis MLO2, though with some species-specific differences in interaction dynamics.

What signaling pathways interact with MLO2 during pathogen response?

MLO2 intersects with multiple signaling pathways during pathogen response:

What approaches can be used for functional analysis of specific MLO2 domains?

Site-directed mutagenesis is a powerful approach for analyzing specific domains within MLO2. For the CAMBD, substitution of key hydrophobic amino acid residues with non-functional amino acids (particularly the LW/RR mutant) has been effective in assessing functional significance . When designing mutagenesis experiments:

For analyzing transmembrane domains or cytoplasmic loops, combining computational prediction tools with experimental validation through chimeric protein analysis has proven effective in MLO family studies .

How can researchers effectively generate and validate MLO2 mutant lines?

Creating and validating MLO2 mutant lines requires careful methodology:

  • Mutant generation approaches:

    • T-DNA insertion lines (readily available through seed stock centers)

    • CRISPR-Cas9 gene editing (for precise modifications)

    • EMS mutagenesis (for random point mutations)

  • Validation steps:

    • Genotyping to confirm mutation (PCR, sequencing)

    • Expression analysis (RT-PCR, qRT-PCR) to verify transcript reduction/elimination

    • Protein analysis (Western blot) if antibodies are available

    • Phenotypic assessment through powdery mildew infection assays

  • Control considerations:

    • Include wild-type controls from the same background

    • Consider using multiple independent mutant alleles

    • For complex phenotypes, complement mutants with the wild-type gene

    • Generate higher-order mutants (e.g., mlo2 mlo6, mlo2 mlo12, mlo2 mlo6 mlo12) to account for functional redundancy

How can transcriptomic approaches be used to understand MLO2-dependent responses?

Transcriptomic analyses have revealed important insights into MLO2-dependent responses. When designing such studies:

  • Compare wild-type, single mutants, and higher-order mutants (mlo2 mlo6 mlo12) to distinguish specific and redundant functions

  • Include multiple time points post-pathogen inoculation to capture temporal dynamics

  • Consider both local and systemic tissues to identify SAR-related transcriptional changes

Key findings from transcriptomic analyses show that mlo2 mlo6 mlo12 mutants exhibit:

  • Increased and accelerated accumulation of defense-related transcripts upon pathogen challenge

  • Non-canonical activation of JA/ET-dependent genes despite biotrophic pathogen interaction

  • Early activation of genes that accumulate much later (72 hpi) in wild-type plants during compatible interactions

These patterns suggest that MLO2 (along with MLO6 and MLO12) enables defense suppression during invasion by adapted powdery mildew fungi .

What is known about the metabolomic changes associated with MLO2 function during pathogen defense?

Metabolomic analyses have identified critical changes in MLO2-dependent defense responses:

  • Indolic antimicrobials:

    • Important for incomplete resistance in mlo2 single mutants

    • Unexpectedly dispensable in mlo2 mlo6 mlo12 triple mutants

    • Adapted powdery mildew fungi can defeat the accumulation of defense-relevant indolic metabolites in an MLO-dependent manner

  • Salicylic acid and related compounds:

    • mlo2 mlo6 mlo12 mutants show developmentally controlled increases in SA levels starting at approximately 6 weeks

    • Higher baseline levels of free and conjugated SA (SAG) compared to wild-type plants

    • Powdery mildew inoculation does not further increase SA/SAG levels in the triple mutant

  • Pipecolic acid (Pip):

    • SAR-activating metabolite that increases systemically in both wild-type and mlo2 mutants after pathogen inoculation

    • MLO2 functions downstream of Pip accumulation in the SAR response

These metabolomic findings suggest that MLO2 acts as a critical downstream component in the execution of SAR, being required for the translation of elevated defense metabolites into effective disease resistance .

How does Arabidopsis MLO2 compare functionally to MLO proteins from other plant species?

Comparative analyses show both conservation and divergence in MLO protein function across plant species:

SpeciesMLO ProteinFunctionSimilarities to AtMLO2Differences from AtMLO2
BarleyMloPowdery mildew susceptibilityConfers susceptibility to powdery mildewNo known role in SAR
RiceOsMloPowdery mildew susceptibilitySimilar CAMBD with conserved hydrophobic residuesSpecies-specific pathogen interactions
TomatoSlMlo1Powdery mildew susceptibilityFunctions as susceptibility factorCrop-specific applications

Key evolutionary insights:

  • The CAMBD region shows high conservation across species, with similar functional significance for key hydrophobic residues

  • The dual role of MLO2 in both fungal susceptibility and bacterial SAR may represent evolutionary adaptation specific to certain plant lineages

  • Phylogenetic analysis places AtMLO2 in clade IV along with AtMLO3, AtMLO6, and AtMLO12, suggesting functional specialization within the larger MLO family

What methods are effective for analyzing functional redundancy among MLO family members?

Analyzing functional redundancy among MLO family members requires systematic approaches:

  • Genetic approaches:

    • Generate and phenotype single, double, and triple mutants

    • Complementation studies with different MLO genes

    • Domain swap experiments between family members

  • Expression analysis:

    • Compare tissue-specific expression patterns

    • Analyze expression responses to various stimuli

    • Determine co-expression networks

Research has shown that MLO2, MLO6, and MLO12 have overlapping but distinct functions, with MLO2 having the strongest effect on powdery mildew susceptibility, while MLO6 and MLO12 make smaller contributions . Expression studies reveal that several phylogenetically closely-related AtMLO genes show similar or overlapping tissue specificity and analogous responsiveness to external stimuli, suggesting functional redundancy, co-function, or antagonistic functions .

What are the unresolved questions about MLO2's dual role in pathogen defense?

Several critical questions remain unanswered regarding MLO2's contradictory roles in defense:

  • Molecular mechanism reconciling:

    • How does the same protein promote susceptibility to fungal pathogens while being essential for resistance to bacterial pathogens?

    • What structural features or interaction partners determine these opposing functions?

  • Evolutionary questions:

    • What selective pressures maintain MLO genes despite their susceptibility-promoting effects for powdery mildew?

    • Do the SAR functions represent the ancestral role of MLO proteins?

  • Signaling integration:

    • How does MLO2 integrate calcium, SA, and potentially JA/ET signals?

    • What are the direct molecular targets of MLO2 during defense activation or suppression?

  • Context-dependent function:

    • Are there specific cellular or tissue contexts that determine MLO2's defensive versus susceptibility-promoting roles?

    • How do environmental factors influence these functions?

These questions represent important areas for future investigation to fully understand the complex role of MLO2 in plant immunity .

What new experimental approaches could advance our understanding of MLO2 function?

Emerging technologies offer opportunities to address remaining questions about MLO2:

  • Structural biology approaches:

    • Cryo-EM studies of the full-length protein to understand conformational changes during signaling

    • Structural analysis of MLO2-interactor complexes

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network modeling of MLO2-dependent defense pathways

  • Advanced cell biology:

    • Super-resolution microscopy to study MLO2 localization during infection

    • Optogenetic approaches to spatiotemporally control MLO2 function

  • Translational approaches:

    • CRISPR-based precise editing of functional domains

    • Exploration of MLO2 modification as a strategy for multi-pathogen resistance

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.