Recombinant Arabidopsis thaliana MLO-like protein 4 (MLO4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana MLO-like Protein 4 (MLO4)

Recombinant Arabidopsis thaliana MLO-like protein 4 (MLO4) is a heptahelical, plasma membrane-localized protein encoded by the At1g11000 gene. It belongs to a family of 15 MLO genes in Arabidopsis thaliana, with distinct roles in developmental and defense-related processes. MLO4 is primarily expressed in root tips and lateral root primordia, where it modulates touch-induced root thigmomorphogenesis (root curling) and auxin transport . The recombinant form, expressed in E. coli with an N-terminal His tag, facilitates biochemical and functional studies of its role in plant physiology .

Role in Root Thigmomorphogenesis

MLO4 and its paralog, MLO11, co-function to regulate root curling through auxin-dependent mechanisms:

  • Phenotype: mlo4 and mlo11 mutants exhibit exaggerated root curling under horizontal growth conditions .

  • Auxin Dependency: Root curling is abolished by auxin transport inhibitors (e.g., NPA) or loss of PIN2 (EIR1/AGR1) function .

  • PIN Protein Dynamics:

    • PIN1-GFP: Reduced expression in vascular tissues of mlo4 roots.

    • PIN2-GFP: Elevated expression in mlo4 mutants, suggesting compensatory auxin transport mechanisms .

Comparative Analysis with Other MLO Proteins

FeatureMLO4MLO2MLO11
Primary RoleRoot thigmomorphogenesisPowdery mildew susceptibilityRoot thigmomorphogenesis
CAM InteractionLimited evidenceStrong CAM bindingSimilar to MLO4
Auxin DependencyDirect (root curling)Indirect (disease resistance)Direct (root curling)
Tissue ExpressionRoot tips, lateral rootsEpidermal cellsRoot tips, lateral roots

MLO4 and MLO11 exhibit non-redundant functions, as mlo4 mlo11 double mutants do not show additive phenotypic severity compared to single mutants .

Amino Acid Sequence Highlights

The full-length sequence (1–573 aa) includes hydrophobic transmembrane domains and cytosolic regions critical for protein-protein interactions . Key motifs include:

  • Transmembrane Helices: Predicted using topology algorithms.

  • C-Terminal Domain: Contains residues analogous to CAMBD in other MLO proteins.

Applications in Research

  1. Root Development Studies: Investigating touch-induced asymmetry and auxin gradient regulation .

  2. Protein-Protein Interaction Assays: Elucidating partnerships with PIN transporters or CAM/CML proteins .

  3. Structural Biology: Solving membrane topology or ligand-binding mechanisms (e.g., auxin).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MLO4; At1g11000; T19D16.26; MLO-like protein 4; AtMlo4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-573
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO4
Target Protein Sequence
MEHMMKEGRSLAETPTYSVASVVTVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMK EELMLLGLISLLLSQSARWISEICVNSSLFNSKFYICSEEDYGIHKKVLLEHTSSTNQSS LPHHGIHEASHQCGHGREPFVSYEGLEQLLRFLFVLGITHVLYSGIAIGLAMSKIYSWRK WEAQAIIMAESDIHAKKTKVMKRQSTFVFHHASHPWSNNRFLIWMLCFLRQFRGSIRKSD YFALRLGFLTKHNLPFTYNFHMYMVRTMEDEFHGIVGISWPLWVYAIVCICINVHGLNMY FWISFVPAILVMLVGTKLEHVVSKLALEVKEQQTGTSNGAQVKPRDGLFWFGKPEILLRL IQFIIFQNAFEMATFIWFLWGIKERSCFMKNHVMISSRLISGVLVQFWCSYGTVPLNVIV TQMGSRHKKAVIAESVRDSLHSWCKRVKERSKHTRSVCSLDTATIDERDEMTVGTLSRSS SMTSLNQITINSIDQAESIFGAAASSSSPQDGYTSRVEEYLSETYNNIGSIPPLNDEIEI EIEGEEDNGGRGSGSDENNGDAGETLLELFRRT
Uniprot No.

Target Background

Function
MLO4 may play a role in modulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Database Links

KEGG: ath:AT1G11000

STRING: 3702.AT1G11000.1

UniGene: At.19090

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Arabidopsis thaliana MLO4 protein?

MLO4 is a transmembrane protein consisting of 573 amino acids with a molecular weight of approximately 65 kDa. The protein contains a signal peptide and seven transmembrane domains, with its C-terminal domain oriented toward the cytoplasm. The complete amino acid sequence is MEHMMKEGRSLAETPTYSVASVVTVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMKEELMLLGLISLLLSQSARWISEICVNSSLFNSKFYICSEEDYGIHKKVLLEHTSSTNQSSLPHHGIHEASHQCGHGREPFVSYEGLEQLLRFLFVLGITHVLYSGIAIGLAMSKIYSWRKWEAQAIIMAESDIHAKKTKVMKRQSTFVFHHASHPWSNNRFLIWMLCFLRQFRGSIRKSDYFALRLGFLTKHNLPFTYNFHMYMVRTMEDEFHGIVGISWPLWVYAIVCICINVHGLNMYFWISFVPAILVMLVGTKLEHVVSKLALEVKEQQTGTSNGAQVKPRDGLFWFGKPEILLRLIQFIIFQNAFEMATFIWFLWGIKERSCFMKNHVMISSRLISGVLVQFWCSYGTVPLNVIVTQMGSRHKKAVIAESVRDSLHSWCKRVKERSKHTRSVCSLDTATIDERDEMTVGTLSRSSSMTSLNQITINSIDQAESIFGAAASSSSPQDGYTSRVEEYLSETYNNIGSIPPLNDEIEIEIEGEEDNGGRGSGSDENNGDAGETLLELFRRT . The protein localizes primarily to the plasma membrane, as confirmed by membrane dye co-localization studies .

What are the primary biological functions of MLO4 in Arabidopsis thaliana?

MLO4 serves multiple important functions in Arabidopsis thaliana. Most notably, it functions as a calcium ion (Ca²⁺) channel that plays an essential role in the root gravity response pathway. Research has demonstrated that MLO4 links touch stimulation to Ca²⁺ elevation in root tip cells, mediating the plant's ability to sense and respond to gravitropic stimuli . Additionally, mutations in MLO4 lead to abnormal root thigmomorphogenesis (touch-induced morphological changes) and altered gravity sensitivity . The protein also interacts with calmodulin-like protein 12 (CML12), and this interaction appears crucial for proper root gravitropism, as both mlo4 and cml12 mutants display similar defects in root gravity responses .

How is MLO4 genetically classified and where is it expressed in Arabidopsis tissues?

MLO4 is genetically classified as a member of the MLO (Mildew Resistance Locus O) protein family. Its gene is designated as At1g11000 with ORF name T19D16.26 . Based on expression analysis using e-FP data from the TAIR website, MLO4 shows distinct expression patterns across various Arabidopsis tissues. While the exact expression level in specific tissues varies, expression analysis indicates that MLO proteins including MLO4 are present in multiple plant tissues, with different MLO family members showing tissue-specific expression patterns. For instance, while some MLO genes like MLO1 are highly expressed in seeds, and others like MLO5, MLO9, and MLO14 are abundant in pollen, MLO4 shows notable expression in root tissues, consistent with its functional role in root gravitropism .

What are the recommended methods for purifying recombinant MLO4 protein?

For purifying recombinant MLO4 protein, researchers should follow a systematic approach that begins with heterologous expression in a suitable host system, most commonly E. coli. Based on available product specifications, recombinant full-length Arabidopsis thaliana MLO4 (1-573aa) with an N-terminal His tag has been successfully expressed in E. coli . After expression, the protein is typically purified through affinity chromatography utilizing the His tag.

The purification process should include the following methodology:

  • Cell lysis under native or denaturing conditions depending on protein solubility

  • Nickel-NTA affinity chromatography to capture the His-tagged MLO4

  • Washing steps with increasing imidazole concentrations

  • Elution with high-concentration imidazole buffer

  • Dialysis to remove imidazole

  • Confirmation of purity via SDS-PAGE (should exceed 90%)

After purification, the protein is typically lyophilized for storage. For reconstitution, researchers should briefly centrifuge the vial prior to opening and reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding glycerol to a final concentration of 5-50% (optimally 50%) is recommended before aliquoting and storing at -20°C/-80°C .

What experimental approaches are effective for studying MLO4 protein interactions?

Multiple complementary experimental approaches have proven effective for studying MLO4 protein interactions, particularly its interaction with calcium-binding proteins. Based on published research, the following methodologies have yielded reliable results:

  • Yeast Two-Hybrid (Y2H) Assays: This technique has been successfully used to screen for interactions between MLO4 and calmodulin/calmodulin-like (CaM/CML) family proteins. Y2H served as the initial method to identify the interaction between MLO4 and CML12 .

  • Luciferase Complementation Imaging (LCI): This method has been employed to verify protein-protein interactions in plant cells. LCI results confirmed that CML12 interacts with the full length of MLO4 in tobacco cells .

  • Bimolecular Fluorescence Complementation (BiFC): This approach not only verified the interaction between MLO4 and CML12 but also provided spatial information, demonstrating that the interaction occurs specifically at the plasma membrane. The interactive signal co-localized with membrane dye FM 4-64, confirming the membrane localization of MLO4 .

  • Two-Electrode Voltage Clamp (TEVC): This electrophysiological technique has been used to examine the channel activity of MLO4 in Xenopus oocytes, revealing that oocytes injected with MLO4 cRNA displayed large inward currents in the presence of Ca²⁺ .

For comprehensive interaction studies, researchers should consider combining multiple approaches to validate results from different experimental systems.

What are the optimal storage conditions for maintaining MLO4 protein stability?

To maintain MLO4 protein stability, researchers should adhere to the following evidence-based storage protocols:

  • Short-term storage (up to one week): Store working aliquots at 4°C .

  • Long-term storage: Store at -20°C/-80°C. For extended storage, -80°C is preferred .

  • Storage form: The recombinant protein is typically supplied as a lyophilized powder, which offers greater stability during shipping and storage .

  • Storage buffer: For reconstituted protein, use a Tris/PBS-based buffer containing 6% Trehalose, pH 8.0. Alternatively, a Tris-based buffer with 50% glycerol optimized for the protein has also been shown to be effective .

  • Aliquoting is essential: Multiple freeze-thaw cycles significantly reduce protein activity. It is strongly recommended to prepare multiple small-volume aliquots upon reconstitution .

  • Reconstitution recommendation: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (5-50% final concentration) is recommended for long-term storage .

Following these storage guidelines will help maintain protein integrity and activity for experimental applications.

How does MLO4 function as a calcium channel, and what techniques can characterize this activity?

MLO4 functions as a calcium-permeable channel that mediates Ca²⁺ influx in response to various stimuli, particularly mechanical touch and gravitropic signals. Research has demonstrated that MLO4 constitutes a novel Ca²⁺-permeable channel essential for touch-induced calcium signaling in Arabidopsis roots .

To characterize the calcium channel activity of MLO4, researchers have successfully employed the following techniques:

  • Two-Electrode Voltage Clamp (TEVC) in Xenopus Oocytes: This electrophysiological approach has revealed that oocytes injected with MLO4 cRNA display large inward currents specifically in the presence of Ca²⁺, providing direct evidence of its channel activity .

  • Functional Complementation in Yeast: MLO4 has been shown to rescue the cch1/mid1 mutant from growth arrest induced by pheromone treatment. This complementation assay provides additional evidence that MLO4 functions as a calcium channel .

  • Calcium Imaging with Fluorescent Indicators: Using GCaMP6s, a genetically encoded calcium indicator, researchers have observed that Ca²⁺ spikes were hardly detectable in mlo4/GCaMP6s seedlings in response to hard surface contact during root elongation. This suggests that MLO4 is critical for touch-induced calcium elevation .

These methodologies collectively provide strong evidence that MLO4 functions as a bona fide calcium channel linking mechanical stimulation to calcium signaling in plant cells. For researchers investigating MLO4 channel properties, combining electrophysiological approaches with calcium imaging techniques offers the most comprehensive characterization.

What is the relationship between MLO4 and calmodulin/calmodulin-like proteins, and how can this be experimentally elucidated?

MLO4 has a well-documented interaction with calmodulin and calmodulin-like proteins, particularly CML12, which appears critical for its biological function. This relationship represents a key aspect of MLO4 research with significant implications for understanding calcium signaling in plants.

The interaction is characterized by:

  • Structural Basis: All MLO proteins, including MLO4, contain a conserved calmodulin-binding domain (CaMBD) in their C-terminal cytoplasmic tail. This domain mediates Ca²⁺-dependent binding of calmodulin .

  • Functional Significance: Genetic analysis demonstrates that both mlo4 and cml12 mutants display similar defects in root gravity response, suggesting that the interaction between these proteins is functionally important for gravitropism .

  • Specificity: The interaction appears to be specific, as MLO4 was identified as interacting with CML12 in a screening of interactions between Arabidopsis MLO and CaM/CML family proteins .

To experimentally elucidate this relationship, researchers have successfully employed multiple complementary approaches:

  • Yeast Two-Hybrid (Y2H) Assays: Initial screening to identify interactions between MLO4 and CaM/CML family members .

  • Luciferase Complementation Imaging (LCI): Verification that CML12 interacts with the full length of MLO4 in tobacco cells .

  • Bimolecular Fluorescence Complementation (BiFC): Confirmation that CML12 interacts specifically with the cytoplasmic domain of MLO4, with the interaction signal detected only on the plasma membrane when using full-length MLO4 .

  • Genetic Approaches: Analysis of single and double mutants (mlo4, cml12, and mlo4 cml12) to assess functional relationships .

  • In vitro Binding Assays: Gel overlay assays have demonstrated Ca²⁺-dependent binding of CaM to the CaMBD of MLO proteins .

For comprehensive characterization of MLO4-calmodulin interactions, researchers should consider combining these approaches, with particular attention to calcium dependency of the interaction and its localization at the membrane.

What are the key considerations when designing genetic studies involving MLO4 mutants?

  • Functional Redundancy: MLO4 shares functional redundancy with other MLO family members, particularly MLO11. Both mlo4 and mlo11 mutants exhibit abnormal root thigmomorphogenesis and gravity sensitivity, suggesting overlapping functions . Consider creating and analyzing double or multiple mutants to address this redundancy.

  • Phenotypic Analysis: Focus on root-related phenotypes, particularly:

    • Root gravitropism assays to measure gravity response

    • Root thigmomorphogenesis (touch response) assays

    • Calcium signaling in response to mechanical stimuli

    • Root growth and development parameters

  • Genetic Background Considerations: Ensure all comparisons use appropriate genetic backgrounds. When analyzing T-DNA insertion lines or CRISPR-generated mutants, backcrossing may be necessary to eliminate background mutations.

  • Complementation Studies: Include genetic complementation with wild-type MLO4 to confirm that observed phenotypes are specifically due to the loss of MLO4 function. Domain swap experiments with the C-terminal cytoplasmic domain have proven informative in understanding MLO4 function .

  • Interaction Partners: Consider the functional relationship with CML12 when designing genetic studies. The similar phenotypes of mlo4, cml12, and mlo4 cml12 mutants suggest that they function in the same pathway . Include analysis of these related mutants when possible.

  • Calcium Signaling Analysis: Incorporate calcium imaging techniques (such as using GCaMP6s calcium indicators) to monitor calcium dynamics in mutant backgrounds, as MLO4 functions as a calcium channel essential for touch-induced calcium signaling .

  • Environmental Conditions: Standardize growth conditions and stimuli application (gravity, touch) as these responses are highly sensitive to environmental variables.

By addressing these considerations in experimental design, researchers can develop more robust genetic studies to elucidate MLO4 function and its role in plant development and environmental responses.

What are common challenges in expressing and purifying functional recombinant MLO4 protein?

Researchers working with recombinant MLO4 protein frequently encounter several challenges during expression and purification. Addressing these issues requires specific methodological approaches:

  • Membrane Protein Solubility: As a seven-transmembrane protein, MLO4 presents significant solubility challenges. To overcome this:

    • Consider using specialized E. coli strains designed for membrane protein expression

    • Optimize induction conditions (temperature, IPTG concentration, induction time)

    • Test different detergents for solubilization (CHAPS, DDM, or Triton X-100)

    • Explore fusion partners that enhance solubility (MBP, SUMO, or thioredoxin)

  • Protein Degradation: Proteolytic degradation during expression and purification can reduce yield:

    • Include protease inhibitors throughout the purification process

    • Work at lower temperatures (4°C) during purification

    • Consider using E. coli strains lacking specific proteases

  • Protein Folding and Activity: Ensuring proper folding of the recombinant protein:

    • The full-length protein (1-573 amino acids) has been successfully expressed in E. coli

    • For functional studies, consider expressing only the cytoplasmic domain, which contains the calmodulin-binding region important for function

    • Verify protein activity through interaction assays with known partners like CML12

  • Storage Stability: Maintaining protein stability after purification:

    • Store as aliquots at -20°C/-80°C to avoid repeated freeze-thaw cycles

    • Add stabilizing agents such as glycerol (5-50%) to storage buffer

    • For working solutions, store at 4°C for no longer than one week

  • Protein Quantification: Accurate determination of protein concentration:

    • Use multiple methods (Bradford, BCA, absorbance at 280nm) to confirm concentration

    • Account for the presence of detergents or other additives that may interfere with quantification

Addressing these challenges systematically will improve the likelihood of obtaining functional recombinant MLO4 protein suitable for biochemical and structural studies.

How can researchers address inconsistent results in MLO4 interaction studies?

Inconsistent results in MLO4 interaction studies can arise from multiple sources. Researchers can implement the following strategies to address these challenges:

  • Validation Across Multiple Interaction Detection Methods: Inconsistencies often result from the limitations of individual techniques. To address this:

    • Confirm interactions using at least three complementary methods

    • The combination of Y2H, LCI, and BiFC has proven effective for validating MLO4-CML12 interactions

    • Include appropriate positive and negative controls in each system

  • Calcium Dependency Considerations: The interaction between MLO4 and calmodulin-like proteins is calcium-dependent, which can lead to variability in results:

    • Carefully control calcium concentrations in interaction buffers

    • Test interactions under both calcium-depleted (+ EGTA) and calcium-supplemented conditions

    • Document calcium concentrations used in all experiments

  • Protein Domain Specificity: Different domains of MLO4 may show different interaction properties:

    • The cytoplasmic C-terminal domain contains the calmodulin-binding domain essential for interaction

    • When using full-length MLO4, ensure proper membrane localization is maintained

    • Consider domain-specific interaction studies to map precise interaction regions

  • Expression Level Variations: Inconsistent expression levels can affect interaction detection:

    • Normalize protein expression levels across experiments

    • Include western blot analysis to confirm expression of interaction partners

    • Consider using inducible expression systems for better control

  • Subcellular Localization: MLO4 is membrane-localized, which can affect interaction dynamics:

    • BiFC assays have shown that MLO4-CML12 interaction occurs specifically at the plasma membrane

    • Verify proper subcellular localization of proteins using fluorescent tags or fractionation methods

    • Use membrane dyes (e.g., FM 4-64) to confirm membrane localization

  • Biological Context: The physiological relevance of interactions may depend on specific conditions:

    • Consider testing interactions under conditions relevant to root gravitropism

    • Include genetic analysis (e.g., phenotyping of mlo4, cml12, and mlo4 cml12 mutants) to support physical interaction data

By systematically addressing these factors, researchers can improve the consistency and reliability of MLO4 interaction studies.

What considerations are important when designing calcium imaging experiments to study MLO4 function?

Calcium imaging is a powerful approach for investigating MLO4 function as a calcium channel, but requires careful experimental design. Researchers should consider the following critical factors:

  • Selection of Calcium Indicators:

    • Genetically encoded calcium indicators (GECIs) like GCaMP6s have been successfully used to study MLO4-mediated calcium signaling

    • Consider indicator sensitivity and dynamic range appropriate for expected calcium changes

    • For root studies, ensure the indicator is expressed in relevant tissues using appropriate promoters

  • Control and Mutant Comparisons:

    • Include wild-type controls alongside mlo4 mutants

    • mlo4/GCaMP6s seedlings show diminished calcium spikes in response to mechanical stimuli compared to wild-type

    • Consider including mlo4 complementation lines expressing functional MLO4 to confirm specificity

  • Stimulus Application:

    • Standardize mechanical stimuli (touch, gravity) to ensure reproducibility

    • For gravitropism studies, use precisely controlled reorientation protocols

    • For touch responses, develop quantifiable mechanical stimulation methods

    • Document stimulus parameters (force, duration, location) in detail

  • Imaging Parameters:

    • Optimize imaging frequency to capture transient calcium signals

    • Balance temporal resolution with phototoxicity concerns

    • Establish consistent imaging regions (e.g., root tip cells for gravitropism studies)

    • Standardize laser power/exposure settings across experiments

  • Data Analysis Approaches:

    • Implement quantitative analysis of calcium signal intensity, duration, and propagation

    • Use ratiometric measurements when possible to control for expression level variations

    • Develop clear criteria for defining calcium spikes or waves

    • Consider spatial analysis to identify cellular regions with highest MLO4-dependent calcium flux

  • Environmental Controls:

    • Maintain consistent temperature, humidity, and light conditions

    • Minimize background mechanical stimulation during experiment setup

    • Consider the effect of the imaging medium on calcium dynamics

  • Pharmacological Approaches:

    • Include calcium channel blockers as controls

    • Consider testing the effect of calmodulin antagonists on MLO4-dependent calcium signaling

    • Document drug concentrations and application methods

By addressing these considerations, researchers can design robust calcium imaging experiments to elucidate the role of MLO4 as a calcium channel mediating mechanical and gravitropic responses in Arabidopsis roots.

What are promising approaches for elucidating the structural details of MLO4 protein?

Despite advances in understanding MLO4 function, detailed structural information remains limited. Several promising approaches could advance structural characterization of this important membrane protein:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Particularly suitable for membrane proteins like MLO4

    • Can resolve structures in near-native environments using detergent micelles, nanodiscs, or liposomes

    • May reveal conformational changes associated with calcium binding and channel opening

  • X-ray Crystallography of Soluble Domains:

    • While crystallizing the full-length protein is challenging, the cytoplasmic C-terminal domain containing the calmodulin-binding region is more amenable to crystallization

    • Co-crystallization with CML12 could provide insights into the interaction interface

  • NMR Spectroscopy for Domain-Specific Analysis:

    • Solution NMR of the cytoplasmic domain could provide dynamic information about calmodulin binding

    • Solid-state NMR approaches might be applicable to the transmembrane regions

  • Advanced Molecular Dynamics Simulations:

    • In silico approaches can predict structural models based on homology and known constraints

    • Simulations of calcium permeation could provide insights into channel function

    • Integration of experimental data with computational models can yield testable hypotheses

  • Cross-linking Mass Spectrometry:

    • Can identify interaction surfaces between MLO4 and partners like CML12

    • Provides distance constraints to inform structural models

    • Compatible with membrane protein complexes

  • Single-Particle Tracking and Super-Resolution Microscopy:

    • Can reveal dynamic behavior and clustering of MLO4 in living cells

    • May provide insights into activation mechanisms in response to stimuli

  • Structure-Function Analysis Through Directed Mutagenesis:

    • Systematic mutation of predicted functional residues

    • Correlation of mutations with electrophysiological properties and calcium permeation

    • Focus on the seven transmembrane domains and the calmodulin-binding region

These approaches, particularly when used in combination, hold promise for revealing the structural basis of MLO4 function as a calcium channel and its interaction with regulatory proteins like CML12.

How might understanding MLO4 function contribute to improving plant stress responses?

Understanding MLO4 function has significant potential for enhancing plant stress resilience through various applications:

  • Gravitropic Response Optimization:

    • MLO4's role in root gravitropism suggests potential for improving root architecture

    • Enhanced gravitropic responses could improve nutrient acquisition in poor soils

    • Targeted modifications of MLO4 might allow for customized root growth patterns to adapt to specific environmental challenges

  • Calcium Signaling Engineering:

    • As a calcium channel, MLO4 represents a key node in calcium-mediated stress signaling networks

    • Modulating MLO4 expression or activity could potentially enhance calcium signatures in response to stresses

    • Cross-talk between touch responses and other stress pathways might be leveraged for improved stress adaptation

  • Mechanical Stress Tolerance:

    • MLO4's involvement in thigmomorphogenesis (touch response) indicates potential applications in improving plant responses to mechanical stresses like wind and rain

    • Enhanced MLO4-mediated signaling might improve lodging resistance in crops

  • Integration with Other MLO Functions:

    • While some MLO proteins (like MLO2) function as susceptibility factors for powdery mildew disease, others including MLO4 have distinct functions in development and stress responses

    • Understanding the functional diversification within the MLO family could allow for targeted modifications that maintain beneficial functions while eliminating detrimental ones

  • Application in Precision Agriculture:

    • Knowledge of MLO4-mediated root responses could inform development of crops with optimized root systems for specific agricultural contexts

    • Integration of MLO4 research with soil sensing technologies could lead to more resilient cropping systems

  • Environmental Adaptation Tools:

    • MLO4's role in sensing and responding to environmental cues makes it relevant for developing plants with enhanced adaptability to changing environments

    • This could be particularly important in the context of climate change adaptation

  • Translational Potential Across Species:

    • The interaction between MLO and CaM/CML families appears to be conserved across plant species

    • Findings from Arabidopsis MLO4 could potentially be translated to crop species for agricultural applications

By elucidating the molecular mechanisms of MLO4 function in calcium signaling and stress responses, researchers can develop targeted approaches to enhance plant resilience to environmental challenges.

What interdisciplinary approaches could advance our understanding of MLO4 signaling networks?

Advancing our understanding of MLO4 signaling networks requires integrative approaches that span multiple disciplines. The following interdisciplinary strategies hold particular promise:

  • Systems Biology Integration:

    • Network analysis to position MLO4 within broader calcium signaling networks

    • Integration of transcriptomics, proteomics, and metabolomics data from mlo4 mutants

    • Mathematical modeling of calcium signaling dynamics with and without functional MLO4

  • Advanced Imaging Technologies:

    • Multiplexed calcium and membrane potential imaging in living roots

    • Super-resolution microscopy to visualize MLO4 distribution and clustering

    • Light sheet microscopy for whole-organ calcium imaging during gravitropic responses

    • Integration with microfluidic devices for controlled application of mechanical stimuli

  • Synthetic Biology Approaches:

    • Engineering synthetic MLO4 variants with altered properties

    • Development of optogenetic tools based on MLO4 to control calcium influx with light

    • Creation of synthetic signaling circuits incorporating MLO4-calcium signaling components

  • Computational Biology and AI:

    • Machine learning approaches to identify patterns in calcium signatures

    • Prediction of MLO4 interaction networks through deep learning

    • In silico screening of compounds that might modulate MLO4 activity

  • Biophysical Methods and Electrophysiology:

    • Patch-clamp studies of MLO4 in native membranes

    • Single-channel recordings to characterize channel properties

    • Force spectroscopy to understand mechanosensing properties

  • Evolutionary and Comparative Biology:

    • Comparative analysis of MLO4 function across plant species

    • Evolutionary analysis of the MLO family to understand functional diversification

    • Identification of conserved signaling mechanisms across diverse plant lineages

  • Chemical Biology:

    • Development of small molecule modulators of MLO4 activity

    • Chemical genetic approaches to create conditionally active MLO4 variants

    • Identification of novel interaction partners through proximity labeling

  • Ecological Studies:

    • Investigation of MLO4 function in plants growing under natural conditions

    • Understanding how environmental variation affects MLO4-dependent responses

    • Correlation of MLO4 variants with adaptation to specific ecological niches

By integrating these interdisciplinary approaches, researchers can develop a more comprehensive understanding of how MLO4 functions within complex signaling networks to mediate plant responses to mechanical stimuli and gravitropic cues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.