Recombinant Arabidopsis thaliana MLO-like protein 6 (MLO6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Biology

MLO6 belongs to the Mildew Resistance Locus O (MLO) family, which modulates cellular responses to biotic and abiotic stressors:

  • Pathogen Susceptibility: While MLO2 is the primary powdery mildew susceptibility factor in A. thaliana, MLO6 and MLO12 are co-orthologs of barley Mlo, with overlapping but less prominent roles .

  • Structural Insights: The CAMBD (residues 439-469) forms an amphiphilic α-helix, as predicted by AlphaFold and helical wheel analysis. Hydrophobic residues (e.g., L456, W459) and basic residues (K461, K465) are conserved across monocots and dicots .

Calmodulin Interaction and Mutational Analysis

MLO6’s CAMBD binds calmodulin (CAM) in a Ca²⁺-dependent manner, a feature validated by:

  • In vitro CAM overlay assays: Mutations (e.g., L456R, W459R) disrupt CAM2 binding .

  • Comparative mutagenesis: Six conserved residues (A452, L456, W459, A463, K461, K465) were substituted, revealing that hydrophobic residues are essential for CAM interaction .

ResidueWild-TypeMutantEffect on CAM Binding
L456LeucineArginineAbrogated
W459TryptophanArginineAbrogated
K461LysineAlanineReduced

Applications in Research

  • Membrane Protein Studies: The A. thaliana super-expression system enables high-yield production (up to 0.4 mg/g fresh weight) of functional MLO6, ideal for structural studies .

  • Pathogen Resistance Engineering: Mutagenesis of CAMBD residues (e.g., L456R) could inform strategies to reduce pathogen susceptibility by disrupting MLO-CAM signaling .

Outstanding Questions

  • Biological Redundancy: The functional overlap between MLO6, MLO2, and MLO12 in powdery mildew responses remains unresolved .

  • Subcellular Localization: While MLO6 is predicted to localize to the plasma membrane, experimental validation is pending .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MLO6; At1g61560; T25B24.9; MLO-like protein 6; AtMlo6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-583
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO6
Target Protein Sequence
MADQVKEKTLEETSTWAVAVVCFVLLLISIVIEKLIHKIGSWFKKKNKKALYEALEKVKA ELMLMGFISLLLTIGQGYISNICIPKNIAASMHPCSASEEARKYGKKDVPKEDEEENLRR KLLQLVDSLIPRRSLATKGYDKCAEKGKVAFVSAYGMHQLHIFIFVLAVCHVIYCIVTYA LGKTKMRRWKKWEEETKTIEYQYSHDPERFRFARDTSFGRRHLSFWSKSTITLWIVCFFR QFFRSVTKVDYLTLRHGFIMAHLAPGSDARFDFRKYIQRSLEEDFKTIVEINPVIWFIAV LFLLTNTNGLNSYLWLPFIPFIVILIVGTKLQVIITKLGLRIQEKGDVVKGTPLVQPGDH FFWFGRPRFILFLIHLVLFTNAFQLAFFVWSTYEFGLKNCFHESRVDVIIRISIGLLVQI LCSYVTLPLYALVTQMGSKMKPTVFNERVATALKSWHHTAKKNIKHGRTSESTTPFSSRP TTPTHGSSPIHLLRNAPHKRSRSVDESFANSFSPRNSDFDSWDPESQHETAETSNSNHRS RFGEEESEKKFVSSSVELPPGPGQIRTQHEISTISLRDFSFKR
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana MLO-like protein 6 (MLO6) may be involved in the modulation of pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and seems to be independent of heterotrimeric G proteins.
Database Links

KEGG: ath:AT1G61560

STRING: 3702.AT1G61560.1

UniGene: At.11096

Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO6 and what is its role in Arabidopsis thaliana?

MLO6 is one of the functional co-orthologs of barley Mlo in Arabidopsis thaliana, alongside MLO2 and MLO12. These proteins modulate powdery mildew susceptibility in a genetically unequal manner, with MLO2 being the primary contributor. The MLO6 protein functions as part of a group of plant-specific calcium channels that enable fungal powdery mildew pathogenesis. When investigating MLO6 function, researchers should consider its role within the context of the MLO co-ortholog family, as the three proteins have partially redundant functions in powdery mildew susceptibility .

What is the structure of recombinant MLO6 protein?

Recombinant MLO6 from Arabidopsis thaliana is a full-length protein consisting of 583 amino acids. Commercial sources typically provide it with a histidine tag for purification purposes . For experimental investigation of the protein structure, researchers should note that MLO proteins contain multiple transmembrane domains and a cytosolic carboxyl-terminal domain that is involved in protein-protein interactions, similar to the well-characterized MLO2 which interacts with calmodulin in a calcium-dependent manner .

How does MLO6 interact with other proteins in Arabidopsis thaliana?

MLO6 demonstrates extensive colocalization with EXO70 proteins, which are constituents of the exocyst complex implicated in vesicle tethering during exocytosis. Specifically, fluorophore-tagged studies show that MLO6-GFP mislocalizes in trichomes of exo70H4 mutants, indicating a functional relationship. When designing protein interaction studies, researchers should employ in vivo protein-protein interaction assays in both plant and yeast cells, as these have successfully revealed isoform-preferential interactions between EXO70.2 subfamily members and MLO proteins .

What are the implications of MLO6 mutations on plant phenotypes and immunity?

The mlo6 mutants, especially when combined with other mlo mutations (such as in mlo2 mlo6 mlo12 triple mutants), display significant phenotypic alterations including changes in trichome secondary cell wall composition. When combined with exo70H4 mutations, mlo6 mutants show synergistically enhanced resistance to powdery mildew. To investigate these phenotypes, researchers should:

  • Generate single, double, and triple mutant combinations

  • Perform detailed cell wall composition analyses using biochemical and Fourier transform infrared spectroscopic techniques

  • Conduct powdery mildew infection assays to quantify resistance levels

  • Examine trichome morphology and cell wall deposition patterns

How can I effectively express and purify recombinant MLO6 protein?

For successful expression and purification of recombinant MLO6:

  • Clone the full-length MLO6 gene (583 amino acids) into an appropriate expression vector (e.g., pTrcHis2-TOPO)

  • Transform the recombinant expression vector into a suitable E. coli expression strain (e.g., E. coli BL21(DE3) pLysS)

  • Induce protein expression with IPTG (typically 1 mM)

  • Purify the histidine-tagged protein using nickel nitrilotriacetic acid (NiNTA) affinity chromatography

  • Validate expression and purification by SDS-PAGE and western blotting

When optimizing expression conditions, consider varying induction temperature (16-37°C), IPTG concentration (0.1-1 mM), and induction time (3-16 hours) to maximize soluble protein yield .

How does MLO6 contribute to cell wall biogenesis in trichomes?

The interaction between MLO6 and EXO70H4 plays a crucial role in trichome cell wall biogenesis. The mlo2 mlo6 mlo12 triple mutant exhibits deficiencies in trichome secondary cell wall composition similar to those observed in exo70H4 mutants. To investigate this function:

  • Use fluorophore-tagged proteins (e.g., MLO6-GFP) to track protein localization

  • Examine the delivery of cell wall components such as PMR4 callose synthase, which is reduced in mlo triple mutant trichomes

  • Perform biochemical analyses of trichome cell wall components

  • Conduct Fourier transform infrared spectroscopy to characterize cell wall composition changes

What methods are most effective for studying MLO6's role in powdery mildew resistance?

To effectively study MLO6's role in powdery mildew resistance:

  • Generate and characterize single, double, and triple mutant combinations of mlo genes

  • Perform powdery mildew infection assays with appropriate fungal strains

  • Quantify infection rates, fungal biomass, and disease progression

  • Analyze the localization of fluorophore-tagged MLO6 during pathogen infection

  • Investigate the interaction between MLO6 and EXO70 proteins during infection

  • Compare resistance phenotypes between different mutant combinations

The synergistic enhancement of powdery mildew resistance in exo70H4 and mlo6 mutant combinations suggests examining protein interaction networks and cellular trafficking pathways during infection .

How can I design experiments to distinguish MLO6 function from other MLO family members?

To distinguish MLO6 function from other MLO family members:

  • Use isoform-specific knockouts, comparing single, double, and triple mutants

  • Perform complementation studies with individual MLO genes under their native promoters

  • Employ isoform-specific antibodies or epitope-tagged constructs for immunolocalization

  • Analyze expression patterns in different tissues and developmental stages

  • Investigate protein-protein interactions specific to each MLO isoform

The genetic unequal manner in which MLO2, MLO6, and MLO12 modulate powdery mildew susceptibility indicates distinct yet overlapping functions that can be dissected through careful experimental design .

What controls should be included when studying MLO6 protein interactions?

When studying MLO6 protein interactions:

  • Include negative controls:

    • Empty vector constructs

    • Unrelated proteins of similar size/structure

    • Mutated versions of MLO6 that disrupt interaction domains

  • Include positive controls:

    • Known interaction partners (e.g., specific EXO70 family members)

    • Other MLO family proteins (MLO2, MLO12) with their known partners

  • Validate interactions using multiple methods:

    • Yeast two-hybrid assays

    • Co-immunoprecipitation

    • Bimolecular fluorescence complementation (BiFC)

    • Fluorescence resonance energy transfer (FRET)

How can contradictory findings about MLO6 function be reconciled in research?

To reconcile contradictory findings about MLO6 function:

  • Consider genetic background differences in Arabidopsis thaliana ecotypes

  • Evaluate experimental conditions (growth conditions, pathogen strains, etc.)

  • Examine the redundancy between MLO family members

  • Assess the expression level of proteins in different studies

  • Compare the methods used for protein detection and functional characterization

  • Analyze the specific domains being studied (full-length vs. truncated proteins)

  • Consider the impact of different tags on protein function and localization

What protein-protein interaction assays are most suitable for studying MLO6?

Based on successful research approaches, the following protein-protein interaction assays are recommended for MLO6:

  • In vivo plant cell assays:

    • Bimolecular fluorescence complementation

    • FRET assays with fluorophore-tagged proteins

    • Co-immunoprecipitation from plant tissues

  • Yeast-based assays:

    • Yeast two-hybrid for identifying novel interactions

    • Split-ubiquitin systems for membrane protein interactions

  • In vitro biochemical approaches:

    • Calmodulin overlay assays (as performed with MLO2)

    • Pull-down assays with recombinant proteins

    • Surface plasmon resonance for kinetic studies

What is the best approach for generating functional MLO6 mutants for research?

For generating functional MLO6 mutants:

  • Site-directed mutagenesis strategy:

    • Target conserved amino acid residues in functional domains

    • For calmodulin binding studies, focus on hydrophobic amino acids in the CAMBD region

    • Replace hydrophobic residues with positively charged ones (e.g., arginine) or hydrophilic residues with alanine

  • Expression and validation:

    • Express mutant proteins as GST or His-tagged fusion proteins

    • Verify expression levels by immunoblot analysis

    • Test functionality through appropriate binding assays

  • In planta validation:

    • Transform mutant constructs into mlo6 background plants

    • Assess complementation of mutant phenotypes

    • Analyze protein localization using fluorophore tags

Comparison of MLO Family Members in Arabidopsis thaliana

MLO ProteinLength (amino acids)Main Biological FunctionMutant PhenotypeKey Interacting Partners
MLO2573Powdery mildew susceptibility, ROS sensitivity, Leaf senescencePowdery mildew resistance, altered trichome cell wallsCAM2/3/5, EXO70H4
MLO6583Powdery mildew susceptibility, Trichome cell wall formationMinor powdery mildew resistance (enhanced in combination)EXO70H4, Likely CAM isoforms
MLO12~570Powdery mildew susceptibilityMinor powdery mildew resistance (enhanced in combination)Unknown
MLO4/11-Root thigmomorphogenesisAltered root thigmotropism-
MLO7-Pollen tube receptionAltered pollen reception-
MLO5/9/15-Pollen tube guidanceAltered pollen tube guidance-

Methods for Analyzing MLO6 Protein-Protein Interactions

MethodAdvantagesLimitationsBest Used For
Yeast Two-HybridHigh-throughput screening, In vivoFalse positives, Membrane proteins challengingInitial interaction screening
BiFCIn vivo visualization, Spatial informationIrreversible complex formationConfirming interactions in plant cells
FRETDynamic interactions, In vivoComplex setup, Signal interpretationStudying interaction dynamics
Co-IPNative conditions, Complex detectionAntibody specificity, Transient interactions difficultValidating interactions in native context
CAM OverlaySpecific for calmodulin bindingIn vitro onlyTesting calcium-dependent interactions

What are the emerging areas of research for MLO6 function?

Emerging research areas for MLO6 include:

  • Investigating the role of MLO6 in cell wall integrity signaling pathways

  • Exploring the calcium-dependent regulatory mechanisms of MLO6

  • Examining the contribution of MLO6 to non-host resistance mechanisms

  • Studying the evolutionary conservation of MLO6 function across plant species

  • Developing targeted approaches to modulate MLO6 activity for enhanced disease resistance

  • Understanding the interplay between MLO6 and hormonal signaling pathways during stress responses

How might CRISPR-Cas9 technology advance MLO6 research?

CRISPR-Cas9 technology offers several advantages for MLO6 research:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.