Recombinant Arabidopsis thaliana MLO-like protein 7 (MLO7)

Shipped with Ice Packs
In Stock

Description

Sources and Availability

Commercially available recombinant MLO7 variants are summarized below:

Catalog No.Source (Host)TagProtein LengthPuritySupplier
MBS7069967E. coliNonePartial≥85%MyBioSource
RFL27454AFE. coliHisFull (1-542)≥90%Creative BioMart
Cell-FreeCell-free expressionNoneFull≥85%MyBioSource

Functional Insights

MLO7 is implicated in several biological processes:

Pollen Tube Reception

  • MLO7 (NORTIA) is critical for pollen tube reception at the female gametophyte. Mutations in MLO7 disrupt signaling between the pollen tube and synergid cells, preventing fertilization .

Developmental Regulation

  • Unlike barley MLO, which modulates powdery mildew susceptibility, A. thaliana MLO7 has no known role in pathogen resistance but contributes to reproductive development .

Calmodulin Interaction

  • The C-terminal CAMBD binds calmodulin (CAM2) in a calcium-dependent manner. Substitutions of hydrophobic residues (e.g., L18R/W21R) reduce CAM binding, suggesting a conserved interaction mechanism across MLO isoforms .

Site-Directed Mutagenesis

  • Mutations in the CAMBD (e.g., LW/RR double mutant) impair CAM2 binding in A. thaliana MLO2, a paralog of MLO7. Similar effects are hypothesized for MLO7 due to conserved CAMBD sequences .

  • Critical residues: Hydrophobic residues (A17, L18, W21, A25) and basic residues (K26, K30) are essential for CAM binding .

Expression Systems

  • Prokaryotic: Full-length MLO7 (1-542 aa) is expressed in E. coli with His tags, yielding ≥90% purity .

  • Eukaryotic: Baculovirus and mammalian systems are used for post-translationally modified variants .

Applications in Research

  • Structural studies: Recombinant MLO7 enables biochemical characterization of its transmembrane topology and CAMBD interactions .

  • Functional assays: Used to study pollen tube guidance and fertilization mechanisms in A. thaliana .

  • Antibody production: Rabbit anti-MLO7 polyclonal antibodies (MyBioSource) facilitate Western blot and ELISA-based detection .

Production Insights

  • Challenges: MLO7’s transmembrane domains complicate solubilization and purification. E. coli-expressed versions often require detergents for stabilization .

  • Optimization: Arabidopsis-based expression systems improve folding and post-translational modifications, though yields remain lower than prokaryotic systems .

Future Directions

  • Structural resolution: Cryo-EM studies of full-length MLO7 could elucidate its role in signal transduction.

  • Interaction mapping: Systematic analysis of MLO7 binding partners beyond CAM2 (e.g., receptor kinases in pollen tubes) is needed .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please specify it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MLO7; NTA; At2g17430; F5J6.19; MLO-like protein 7; AtMlo7; Protein NORTIA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-542
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO7
Target Protein Sequence
MITRSRCRRSLLWFLVFHGGATATGAPSGGKELSQTPTWAVAVVCTFLILISHLLEKGLQ RLANWLWKKHKNSLLEALEKIKAELMILGFISLLLTFGEPYILKICVPRKAALSMLPCLS EDTVLFQKLAPSSLSRHLLAAGDTSINCKQGSEPLITLKGLHQLHILLFFLAIFHIVYSL ITMMLSRLKIRGWKKWEQETLSNDYEFSIDHSRLRLTHETSFVREHTSFWTTTPFFFYVG CFFRQFFVSVERTDYLTLRHGFISAHLAPGRKFNFQRYIKRSLEDDFKLVVGISPVLWAS FVIFLLFNVNGWRTLFWASIPPLLIILAVGTKLQAIMATMALEIVETHAVVQGMPLVQGS DRYFWFDCPQLLLHLIHFALFQNAFQITHFFWIWYSFGLKSCFHKDFNLVVSKLFLCLGA LILCSYITLPLYALVTQMGSHMKKAVFDEQMAKALKKWHKDIKLKKGKARKLPSKTLGVS ESFSLSSSSSATTLHRSKTTGHSSNIIYYKQEDEEDEMSDLEAGAEDAIDRIQQQEMQFH NS
Uniprot No.

Target Background

Function
MLO7, a MLO-like protein in Arabidopsis thaliana, may play a role in modulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins. MLO7 is also involved in controlling pollen tube reception within the female gametophyte synergids.
Gene References Into Functions
  1. MLO7 plays a critical role in pollen tube reception, which is dependent on its localization within synergids to a Golgi-associated compartment before pollen tube arrival. This suggests that pollen tube-triggered regulation of the synergid secretory system is essential for synergid function during pollination. PMID: 28724621
  2. Research indicates that pollen tube (PT) reception and powdery mildew (PM) infection share molecular components. NTA, identified in the context of PM resistance, and FERONIA control PT reception. Interestingly, fer mutants also exhibit PM resistance, revealing a new function for FER. PMID: 21071669
Database Links

KEGG: ath:AT2G17430

STRING: 3702.AT2G17430.1

UniGene: At.28692

Protein Families
MLO family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endomembrane system. Note=In synergids of unfertilized mature female gametophytes, present in a punctate pattern of endomembranes throughout the cytoplasm. Become polarly localized to the basal half of the synergids, to the filiform apparatus, upon pollen tube arrival at the micropyle. This relocalization upon fertilization requires FER.
Tissue Specificity
Restricted to pollen, synergids, pistils and immature anthers. Also detected in seedlings, leaves, stems and inflorescens.

Q&A

What is MLO7 and how is it classified within the MLO family?

MLO7 (also known as AtMLO7, NORTIA, or NTA) is a seven-transmembrane domain protein belonging to the Mildew Resistance Locus O (MLO) family in Arabidopsis thaliana. It is one of 15 members in the Arabidopsis MLO family, which represents the largest family of seven-transmembrane domain proteins in plants . MLO7 is encoded by the gene located at locus F5J6.19/F5J6_19 and is classified as a MILDEW RESISTANCE LOCUS O protein . Unlike MLO4, MLO11, and MLO14, which form a distinct phylogenetic clade with demonstrated roles in root development, MLO7 belongs to a separate clade within the MLO family phylogeny .

What is the molecular structure of recombinant MLO7?

Recombinant MLO7 is characterized as a seven-transmembrane domain protein with structural features typical of the MLO family. The protein contains membrane-spanning domains that anchor it to cellular membranes, with both cytosolic and extracellular portions that facilitate interactions with intracellular signaling components and external stimuli respectively . When produced recombinantly, MLO7 is typically purified to ≥85% purity as determined by SDS-PAGE analysis . The protein can be produced in multiple expression systems including E. coli, yeast, baculovirus-infected insect cells, mammalian cells, and cell-free expression systems, each potentially yielding slight variations in post-translational modifications .

What alternative names and identifiers are associated with MLO7?

MLO7 is referenced in scientific literature and databases under several alternative names and identifiers:

  • MLO-like protein 7

  • AtMLO7

  • MILDEW RESISTANCE LOCUS O 7

  • NORTIA

  • NTA

  • F5J6.19

  • F5J6_19

  • At2g17430 (gene identifier)

  • Seven transmembrane MLO family protein (functional classification)

How can researchers effectively express and purify recombinant MLO7?

Recombinant MLO7 can be expressed in multiple host systems, each with distinct advantages for specific research applications. For structural studies requiring large quantities of protein, E. coli expression systems may be preferable despite potential challenges with membrane protein folding. For studies requiring post-translational modifications, yeast, baculovirus-infected insect cells, or mammalian expression systems are recommended .

A general purification workflow involves:

  • Selection of appropriate expression vector containing MLO7 coding sequence

  • Transformation into chosen host system

  • Optimization of expression conditions (temperature, induction time, media composition)

  • Cell lysis using detergents suitable for membrane proteins

  • Affinity chromatography using tagged MLO7

  • Secondary purification steps (ion exchange, size exclusion chromatography)

  • Quality assessment via SDS-PAGE to confirm ≥85% purity

Cell-free expression systems represent an alternative approach that may overcome difficulties associated with membrane protein toxicity in living cells .

What experimental methods are suitable for studying MLO7 function in planta?

Based on approaches used with other MLO family members, several experimental methods are recommended for studying MLO7 function:

  • T-DNA insertion lines analysis: Isolation and characterization of null mutant alleles provides insights into MLO7's biological function, as demonstrated with other MLO family members .

  • RT-PCR verification: This technique confirms knockout status by demonstrating absence of full-length transcripts in mutant lines .

  • Phenotypic analysis: Careful observation of growth patterns, particularly in specialized tissues where MLO7 is expressed .

  • Complementation studies: Introduction of wild-type MLO7 into mutant backgrounds to confirm phenotype rescue .

  • Fluorescent protein fusions: GFP-MLO7 fusions for subcellular localization studies .

  • Transcriptional analysis: RNA-seq or microarray to identify downstream genes affected by MLO7 disruption .

What is the role of MLO7 in plant development compared to other MLO family members?

Unlike MLO4 and MLO11, which have been demonstrated to influence root development and particularly root curvature patterns, the specific developmental role of MLO7 has not been as extensively characterized in the provided research . MLO4 and MLO11 mutants exhibit distinctive root coiling phenotypes with exaggerated spiral-like root growth patterns, while MLO14 mutations do not produce this phenotype .

The following table compares phenotypic characteristics of different MLO mutants:

MLO ProteinRoot CurlingRoot SkewingGravitropic ResponseAdditional Phenotypes
MLO4IncreasedDecreasedNormalProminent waving pattern
MLO11IncreasedNormalNormalSpiral-like growth
MLO14NormalNormalNormalNo distinctive phenotype
MLO7Not reportedNot reportedNot reportedRequires further research

While MLO7's developmental role requires further investigation, based on patterns observed with other MLO proteins, it likely functions in specific cell types or developmental processes, potentially in response to environmental or pathogen stimuli .

What is known about MLO7's potential role in pathogen resistance?

The MLO family was initially identified through studies of powdery mildew susceptibility, with certain MLO proteins functioning as susceptibility factors that, when mutated, confer resistance to powdery mildew . While the specific role of MLO7 in pathogen interactions has not been directly described in the provided research, analysis of other MLO family members provides context for potential functions.

In rice, for example, OsMLO3 is upregulated by Magnaporthe oryzae infection, suggesting involvement in pathogen response pathways . By extension, MLO7 may play a role in Arabidopsis immune responses, potentially as either a susceptibility factor or resistance component depending on the pathogen type. Research using MLO7 knockout lines challenged with various pathogens would help elucidate its specific function in plant immunity .

How does MLO7 potentially interact with cellular signaling pathways?

As a seven-transmembrane domain protein, MLO7 likely functions as a receptor or signaling component in the plasma membrane. Other MLO family members interact with calcium and calmodulin-mediated signaling pathways, suggesting MLO7 may have similar interactions . The exact nature of MLO7's signaling role remains to be fully elucidated, but several potential mechanisms can be predicted:

  • Calcium signaling: MLO proteins may influence calcium ion fluxes across membranes in response to stimuli .

  • Hormone signaling integration: MLO proteins potentially interact with plant hormone signaling networks, particularly those involved in development and stress responses .

  • Light response pathways: MLO family members have been implicated in light-responsive methylerythritol 4-phosphate pathway signaling .

  • Cytoskeletal interactions: The root phenotypes of other MLO mutants suggest possible interactions with cytoskeletal components that regulate directional growth .

How can researchers address challenges in studying membrane-localized MLO7?

Membrane proteins like MLO7 present specific experimental challenges that researchers must overcome:

  • Protein solubilization: Use of appropriate detergents is critical. Initial screening with a panel of detergents (DDM, LDAO, Triton X-100) can identify optimal conditions for MLO7 solubilization while maintaining protein structure and function.

  • Functional assays: Developing robust assays for MLO7 activity requires consideration of its native cellular environment. Liposome reconstitution or nanodiscs can provide membrane environments that better maintain function compared to detergent micelles.

  • Structural analysis: Cryo-electron microscopy has emerged as a powerful technique for membrane protein structure determination, potentially overcoming difficulties associated with crystallizing transmembrane proteins like MLO7.

  • Interaction studies: Proximity labeling approaches (BioID, APEX) can identify proteins interacting with MLO7 in its native membrane environment, providing functional insights without requiring complete solubilization .

What strategies can resolve conflicting data regarding MLO7 function?

When researchers encounter conflicting results regarding MLO7 function, systematic evaluation is essential:

  • Genetic background effects: Ensure all mutant lines are in the same genetic background or use multiple backcrosses to the wild-type parent to minimize background effects, as demonstrated in studies of other MLO family members .

  • Growth condition standardization: MLO phenotypes can be sensitive to growth conditions. For example, root coiling phenotypes of mlo4 and mlo11 mutants were robust on minimal media with varying sucrose content but less prominent on medium containing Murashige and Skoog salts .

  • Allelic series analysis: Examine multiple independent mutant alleles of MLO7 to confirm phenotypic consistency, as was done with mlo4-1, mlo4-3, and mlo4-4 alleles .

  • Complementation verification: Express the wild-type MLO7 under native promoter control in mutant backgrounds to confirm phenotype rescue.

  • Tissue-specific expression: Consider that MLO7 may function in specific tissues or developmental stages, requiring targeted analysis approaches .

How does MLO7 compare functionally and structurally to other Arabidopsis MLO proteins?

The Arabidopsis MLO family consists of 15 members with varying functions and tissue expression patterns. While detailed comparative analysis of MLO7 specifically is not provided in the research results, we can extract insights from studies of the broader family:

  • Phylogenetic relationships: MLO4, MLO11, and MLO14 form a distinct clade within the Arabidopsis MLO family with demonstrated roles in root development. MLO7 belongs to a separate phylogenetic group, suggesting potentially different functional specialization .

  • Expression patterns: Different MLO proteins show tissue-specific expression patterns that correlate with their functions. Detailed expression analysis of when and where MLO7 is expressed would provide clues to its functional role .

  • Phenotypic effects: While mlo4 and mlo11 mutants show distinctive root growth phenotypes, and other MLO proteins like MLO2, MLO6, and MLO12 function as co-orthologs of barley MLO in powdery mildew susceptibility, the specific phenotypic consequences of MLO7 disruption require further characterization .

What can cross-species analysis reveal about MLO7 conservation and function?

Comparative analysis across plant species can provide valuable insights into MLO7 function:

  • Evolutionary conservation: Identifying MLO7 orthologs in other plant species can reveal conserved domains that are likely functionally important. The MLO family is plant-specific, suggesting specialized roles in plant-specific processes .

  • Rice MLO analysis: Studies in rice have identified MLO genes responding to abiotic stresses including heat and cold. Additionally, OsMLO3 responds to Magnaporthe oryzae infection. These findings suggest potential roles for Arabidopsis MLO7 in stress responses that could be experimentally investigated .

  • Functional divergence: Comparing MLO7 sequence and structure to MLO proteins with known functions (such as those conferring powdery mildew susceptibility) can highlight unique features that may indicate specialized functions .

What are promising research directions for elucidating MLO7 function?

Several research approaches could significantly advance understanding of MLO7 function:

  • Comprehensive transcriptomics: RNA-seq analysis comparing wild-type and mlo7 mutant plants under various conditions (developmental stages, abiotic stresses, pathogen challenges) could reveal pathways affected by MLO7 disruption.

  • Proteomics approaches: Identification of MLO7-interacting proteins through co-immunoprecipitation coupled with mass spectrometry would provide insights into molecular pathways involving MLO7.

  • CRISPR-based approaches: Generation of precise mutations in specific MLO7 domains could create an allelic series revealing the importance of different protein regions.

  • Cell-specific expression analysis: Determining where and when MLO7 is expressed using reporter gene fusions would provide contextual information for functional studies.

  • Stress response evaluation: Given the involvement of rice MLO genes in abiotic stress responses, investigating MLO7's potential role in Arabidopsis responses to heat, cold, or other stresses represents a promising direction .

How can researchers optimize antibody-based detection methods for MLO7?

For researchers utilizing the available rabbit polyclonal antibody against Arabidopsis thaliana MLO7 , several considerations can optimize detection:

  • Epitope accessibility: As a transmembrane protein, certain epitopes may be masked in native conditions. Using different extraction methods (varied detergents or denaturation conditions) can help optimize epitope exposure.

  • Cross-reactivity assessment: Test antibody specificity using mlo7 knockout plants as negative controls to ensure signals are specific to MLO7.

  • Application optimization:

    • Western blot: 1:1000-1:5000 dilution range, optimized based on signal-to-noise ratio

    • ELISA: Titration to determine optimal concentration for plate coating and detection

    • Immunolocalization: Fixation method optimization critical for preserving epitope recognition

  • Signal amplification: For low-abundance detection, consider secondary antibody systems with higher sensitivity or tyramide signal amplification approaches.

What are the challenges in distinguishing MLO7 function from other MLO family members?

Researching MLO7 function presents several challenges due to potential functional redundancy within the MLO family:

  • Generate higher-order mutants: As demonstrated with other MLO proteins, single mutants may show subtle or no phenotypes due to functional redundancy. Creating double, triple, or higher-order mutants combining mlo7 with mutations in phylogenetically related MLO genes may be necessary to observe clear phenotypes .

  • Tissue-specific analysis: Different MLO proteins may function in specific tissues or developmental contexts. Detailed expression analysis using promoter-reporter fusions can identify where MLO7 is uniquely expressed versus tissues with overlapping expression of multiple MLO genes .

  • Conditional phenotypes: Some MLO functions may only be apparent under specific environmental conditions or stresses. Testing mlo7 mutants under various conditions (different light regimes, nutrient conditions, biotic and abiotic stresses) may reveal condition-specific phenotypes .

How should researchers interpret physiological phenotypes in MLO7 mutants?

When analyzing physiological phenotypes in mlo7 mutant plants, several considerations will ensure robust interpretation:

  • Multiple allele analysis: Examine at least two independent mutant alleles to confirm that observed phenotypes are due to MLO7 disruption rather than background mutations or T-DNA insertion effects .

  • Complementation testing: Introduce the wild-type MLO7 gene under control of its native promoter into mutant backgrounds to verify that it rescues observed phenotypes.

  • Quantitative phenotyping: Develop quantitative assays for phenotypic analysis, similar to the root angle and root span measurements used for characterizing mlo4 and mlo11 mutants .

  • Environmental controls: Standardize growth conditions rigorously, as MLO-related phenotypes can be sensitive to media composition, light conditions, and other environmental variables .

  • Temporal analysis: Monitor phenotypes throughout development, as MLO functions may be stage-specific rather than constitutive.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.