Recombinant Arabidopsis thaliana MLO-like protein 8 (MLO8)
Shipped with Ice Packs 
In Stock 
Description
Recombinant Production and Purification
MLO8 is typically produced in E. coli using SUMO fusion vectors to enhance solubility . Key steps include:
-
Cloning: The MLO8 gene (residues 1–593) is inserted into the pE-SUMO vector .
-
Purification: SUMO protease cleavage followed by nickel-affinity chromatography .
-
Yield: ~0.1–1.0 mg/mL post-reconstitution, with >90% purity confirmed via SDS-PAGE .
Table 2: Production Parameters
| Parameter | Details |
|---|---|
| Storage Conditions | -20°C/-80°C in Tris/PBS buffer with 6% trehalose |
| Reconstitution Buffer | Deionized water + 50% glycerol (recommended) |
| Stability | Avoid repeated freeze-thaw cycles |
Applications in Research
Recombinant MLO8 is primarily used for:
-
Antibody Production: As an immunogen for generating anti-MLO8 antibodies .
-
Structural Studies: NMR or crystallography to resolve transmembrane domain architecture .
-
Interaction Screens: Yeast two-hybrid assays to identify binding partners (e.g., calmodulin or receptor kinases) .
Research Gaps and Future Directions
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
MLO8; At2g17480; F5J6.21; MJB20.4; MLO-like protein 8; AtMlo8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO8
Target Protein Sequence
MGIIDGSLLRRLICLCLWCLLGGGVTVVTAEDEKKVVHKQLNQTPTWAVAAVCTFFIVVS
VLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGFISLLLTFGQTYILDICIPSHVA
RTMLPCPAPNLKKEDDDNGESHRRLLSFEHRFLSGGEASPTKCTKEGYVELISAEALHQL
HILIFFLAIFHVLYSFLTMMLGRLKIRGWKHWENETSSHNYEFSTDTSRFRLTHETSFVR
AHTSFWTRIPFFFYVGCFFRQFFRSVGRTDYLTLRNGFIAVHLAPGSQFNFQKYIKRSLE
DDFKVVVGVSPVLWGSFVLFLLLNIDGFKMMFIGTAIPVIIILAVGTKLQAIMTRMALGI
TDRHAVVQGMPLVQGNDEYFWFGRPHLILHLMHFALFQNAFQITYFFWIWYSFGSDSCYH
PNFKIALVKVAIALGVLCLCSYITLPLYALVTQMGSRMKKSVFDEQTSKALKKWRMAVKK
KKGVKATTKRLGGDGSASPTASTVRSTSSVRSLQRYKTTPHSMRYEGLDPETSDLDTDNE
ALTPPKSPPSFELVVKVEPNKTNTGETSRDTETDSKEFSFVKPAPSNESSQDR
Uniprot No.
Target Background
Function
This protein may play a role in modulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and does not seem to require heterotrimeric G proteins.
Database Links
Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
