Recombinant Arabidopsis thaliana MLO-like protein 9 (MLO9)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

ParameterSpecification
Expression HostEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer with 6% Trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL) with optional 50% glycerol

This recombinant protein (Product Code: CSB-CF836027DOA) is validated for use in ELISA and Western blotting .

Pollen Tube Integrity

  • MLO9, alongside MLO1, MLO5, and MLO15, ensures pollen tube stability. The mlo1mlo5mlo9 triple mutant exhibits a 3–4× higher pollen tube bursting rate compared to wild-type plants .

  • Required for calcium gradient establishment during pollen tube growth via RALF peptide signaling pathways .

Calcium Signaling

  • The CAMBD of MLO proteins binds calmodulin (CAM) in a Ca²⁺-dependent manner. Mutations (e.g., L456R/W459R in MLO2) reduce CAM binding affinity, suggesting a conserved mechanism in MLO9 .

Research Findings

Study FocusKey OutcomeCitation
Genetic Redundancymlo1mlo5mlo9 mutants show severe fertility defects due to pollen tube defects
CAM InteractionCAMBD mutations disrupt calcium signaling, altering susceptibility to biotic stress
Protein StabilityLyophilization with trehalose enhances long-term storage without aggregation

Applications in Research

  • Antibody Production: Rabbit polyclonal antibodies (e.g., CSB-PA836027XA01DOA) target recombinant MLO9 for immunodetection .

  • Structural Studies: Used to map CAMBD residues critical for protein-protein interactions .

  • Functional Assays: In vitro reconstitution of calcium channel activity in pollen tubes .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We recommend storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
MLO9; At1g42560; F8D11.2; T8D8.5; MLO-like protein 9; AtMlo9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-460
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
MLO9
Target Protein Sequence
MAGGGGGGGGEGPRQLDQTPTWAVSTVCGVIILISIILELIIHKVGEVFERKKKKALFEA LEKIKNELMVLGFISLLLTFGQNYIASICVPSRYGHAMSFCGPYDGPSEDDRKKLKKTDH AMRILYSVQRRSLADAPPVNCKKDYVALISLNALHQVHIFIFFLAVFHVIYSAITMMLGR AKIRGWKVWEQEVIHEQEMMNDPSRFRLTHETSFVREHVNSWASNKFFFYVMCFFRQILR SVRKSDYLTMRHGFISVHLAPGMKFDFQKYIKRSLEDDFKVVVGIRPELWAFVMLFLLFD VHGWYVTAVITMIPPLLTLAIGTKLQAIISYMALEIQERHAVIQGMPVVNVSDQHFWFEK PDLVLHMIHFVLFQNAFEITYFFWIWYEFGLRSCFHHHFGLIIIRVCLGVGVQFLCSYIT LPLYALVTQMGSTMKRSVFDEQTSKALEQWHKKARKKNEK
Uniprot No.

Target Background

Function
This protein may play a role in modulating pathogen defense and leaf cell death. Its activity appears to be regulated by Ca(2+)-dependent calmodulin binding and may not require heterotrimeric G proteins.
Database Links
Protein Families
MLO family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MLO9 and what is its significance in plant biology?

MLO9 (MLO-like protein 9) is a member of the MLO (Mildew Resistance Locus O) family in Arabidopsis thaliana. Recent research has revealed that MLOs function as calcium channels unique to plants, indicating their crucial role in cellular signaling pathways . MLO9 is particularly significant because it is expressed in pollen tubes and plays an important role in male fertility and pollen tube integrity . Understanding MLO9 contributes to our broader knowledge of plant reproductive mechanisms and calcium-mediated signaling pathways in plants.

What are the known synonyms and identifiers for MLO9?

To avoid confusion in the literature, researchers should be aware of the various nomenclature used to describe MLO9:

  • MLO9

  • At1g42560

  • F8D11.2

  • T8D8.5

  • MLO-like protein 9

  • AtMlo9

The UniProt identifier for this protein is Q94KB4 . Using consistent identifiers in publications facilitates cross-referencing and database searches, enhancing reproducibility and collaborative research efforts.

What expression systems are optimal for producing recombinant MLO9 protein?

E. coli expression systems have been successfully used to produce recombinant MLO9 protein with an N-terminal His tag . When expressing MLO9, researchers should consider the following methodological factors:

  • Vector Selection: Vectors compatible with E. coli expression that incorporate an N-terminal His tag facilitate purification.

  • Expression Conditions: Optimizing temperature, induction time, and IPTG concentration is critical for maximizing protein yield.

  • Protein Folding: As a membrane protein, MLO9 may require specific conditions to achieve proper folding.

  • Solubilization: Membrane proteins often require detergents for solubilization during purification processes.

The recombinant protein is typically obtained as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

What are the recommended storage conditions for MLO9 protein preparations?

For optimal stability and activity retention of MLO9 protein preparations, the following storage conditions are recommended:

  • Long-term Storage: Store at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use.

  • Working Aliquots: Store at 4°C for up to one week.

  • Storage Buffer: Use Tris/PBS-based buffer, containing 6% Trehalose, at pH 8.0.

  • Reconstitution: Briefly centrifuge vials before opening and reconstitute in deionized sterile water.

  • Cryoprotection: Add 5-50% glycerol (final concentration) and aliquot for long-term storage.

  • Stability Considerations: Avoid repeated freeze-thaw cycles as they can compromise protein integrity .

These storage practices help maintain protein stability and functional integrity for experimental consistency.

How does MLO9 function as a calcium channel and what methods can detect this activity?

Recent research has established that MLO9 functions as a calcium (Ca²⁺) channel, requiring specific regulators for activation . To study this channel activity, researchers have employed these methodological approaches:

  • Ca²⁺ Imaging: When co-expressed with MARIS R240C in mammalian cell systems (such as COS7 cells), MLO9 mediates calcium influx that can be visualized using calcium-sensitive fluorescent dyes .

  • Patch-Clamp Electrophysiology: Direct measurement of transport activity reveals large inward currents when MLO9 is co-expressed with MARIS R240C in HEK293T cells .

  • Pharmacological Inhibition: Typical Ca²⁺ channel blockers like lanthanum (La³⁺) inhibit MLO9-mediated inward currents, confirming channel functionality .

  • Control Experiments: When expressed alone without MARIS R240C, MLO9 does not mediate Ca²⁺ entry, indicating the requirement for specific regulators .

These complementary approaches provide robust evidence for MLO9's function as a calcium channel and offer researchers multiple experimental options for functional characterization.

What is the relationship between MLO9 and pollen tube integrity?

MLO9 plays a crucial role in maintaining pollen tube integrity, as evidenced by genetic studies. This relationship can be investigated through several experimental approaches:

  • Genetic Knockout Studies: The triple mutant mlo1mlo5mlo9 shows significantly higher pollen tube bursting rates compared to wild type, indicating functional redundancy among these MLO proteins in maintaining pollen tube integrity .

  • Male Transmission Efficiency Assays: Both mlo5mlo9 double mutant and mlo1mlo5mlo9 triple mutant exhibit reduced male transmission efficiency, with the triple mutant showing more severe defects, confirming the role of these proteins in male fertility .

  • Functional Redundancy Analysis: The inability to isolate a mlo1mlo5mlo9mlo15 quadruple mutant despite extensive screening suggests a critical requirement for at least one functional MLO protein from this group for fertility .

These findings suggest that MLO9, along with related MLO proteins, forms part of a redundant system essential for maintaining pollen tube integrity during growth.

How does the RALF signaling pathway interact with MLO9?

The RALF (Rapid Alkalinization Factor) signaling pathway activates MLO calcium channels, including MLO9. This interaction can be studied through these methodological approaches:

  • Split-Luciferase Complementation (LUC) Assay: This technique can detect protein-protein interactions between MLO proteins and RALF pathway components such as MARIS .

  • Co-expression Studies: When co-expressed with MARIS R240C, MLO9 mediates calcium influx, suggesting a functional relationship between the RALF signaling pathway and MLO9 activation .

  • Genetic Interaction Analysis: Mutants in both MLO genes and RALF pathway components show similar pollen tube bursting phenotypes, indicating they function in the same biological pathway .

  • Calcium Imaging in Multiple Genetic Backgrounds: Comparing calcium dynamics in wild-type, RALF pathway mutants, and MLO mutants can elucidate the signaling relationships between these components .

These approaches collectively demonstrate that the RALF signaling pathway regulates MLO9 function, particularly in the context of pollen tube growth and integrity.

What experimental designs are most appropriate for studying MLO9 function in plants?

When investigating MLO9 function, researchers should consider these experimental design approaches:

Choosing the appropriate experimental design depends on research questions, available resources, and the specific aspects of MLO9 function being investigated.

How can researchers control for functional redundancy when studying MLO9?

Controlling for functional redundancy in MLO9 research presents a significant challenge, as evidenced by the overlapping functions of MLO1, MLO5, MLO9, and MLO15. Consider these methodological approaches:

  • Higher-Order Mutant Generation: Create double, triple, or quadruple mutants to overcome functional redundancy. For example, the mlo1mlo5mlo9 triple mutant revealed phenotypes not observed in single mutants .

  • CRISPR/Cas9 Multiplexing: Target multiple MLO genes simultaneously to generate higher-order mutants more efficiently than traditional crossing methods .

  • Conditional Knockout Systems: Utilize inducible systems to control the timing and tissue specificity of gene silencing, particularly valuable when complete knockout causes lethality (as suggested by the inability to isolate quadruple mutants) .

  • Quantitative Phenotyping: Employ sensitive phenotyping methods that can detect subtle effects in single or double mutants that might be masked by redundancy.

  • Dose-Response Experiments: Create an allelic series with varying numbers of functional MLO genes to quantify the relationship between MLO function and phenotypic outcomes.

These approaches help overcome the experimental challenges posed by functional redundancy when investigating MLO9 biology.

What are the methodological challenges in studying MLO9 calcium channel activity in native plant tissues?

Investigating MLO9 calcium channel activity in native plant tissues presents several methodological challenges that researchers must address:

Researchers addressing these challenges might employ genetically encoded calcium indicators with subcellular targeting, fast confocal or light-sheet microscopy, and conditional genetic systems to advance our understanding of MLO9 function in native contexts.

How can contradictory data in MLO9 research be reconciled through experimental design?

When faced with contradictory data regarding MLO9 function or regulation, researchers should consider these methodological approaches:

  • Parallel Design with Multiple Controls: Implement experimental designs where subjects are randomly assigned to different experimental conditions with multiple control groups to identify potential sources of variation . This design can help determine whether contradictions arise from methodological differences or biological complexity.

  • Crossover Design for Sequential Testing: Use crossover designs where experimental units experience multiple treatment conditions in sequence, allowing direct comparison of contradictory observations within the same biological system .

  • Meta-analytical Approach: Systematically analyze published studies with contradictory findings, focusing on methodological differences, genetic backgrounds, and environmental conditions that might explain discrepancies.

  • Multivariate Analysis: Apply statistical methods that account for multiple variables simultaneously to identify complex interactions that might explain apparently contradictory observations.

  • Independent Verification: Employ multiple, independent methodologies to test the same hypothesis, as MLO9's calcium channel activity was confirmed using both calcium imaging and patch-clamp electrophysiology .

These methodological approaches can help researchers resolve contradictions and develop more nuanced models of MLO9 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.