Recombinant Arabidopsis thaliana NAC domain-containing protein 69 (NAC69)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NAC69; NTL13; NTM2; At4g01550; F11O4.5; NAC domain-containing protein 69; ANAC069; Protein NAC WITH TRANSMEMBRANE MOTIF 2; Protein NTM1-like 13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-457
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NAC69
Target Protein Sequence
MVKDLVGYRFYPTGEELINHYLKNKILGKTWLVDEAISEINICSYDPIYLPSLSKIKSDD PVWYFFCPKEYTSAKKKVTKRTTSSGYWKATGVDRKIKDKRGNRGEIGIKKTLVYYEGRV PKGVWTPWVMHEYHITCLPQDQRNYVICQVMYKGEDGDVPSGGNNSSEPSQSLVSDSNTV RATSPTALEFEKPGQENFFGMSVDDLGTPKNEQEDFSLWDVLDPDMLFSDNNNPTVHPQA PHLTPNDDEFLGGLRHVNREQVEYLFANEDFISRPTLSMTENRNDHRPKKALSGIIVDYS SDSNSDAESISATSYQGTSSPGDDSVGSSNRQFLQTGGDEILSSCNDLQTYGEPSISSST RQSQLTRSIIRPKQEVKQDTSRAVDSDTSIDKESSMVKTEKKSWFITEEAMERNRNNPRY IYLMRMIIGFILLLALISNIISVLQNLNPAMKFDRER
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana NAC domain-containing protein 69 (NAC69) is a transcription activator activated by proteolytic cleavage via regulated intramembrane proteolysis (RIP). It plays a role in salt stress responses during seed germination and seedling growth. NAC69 binds to the auxin-responsive IAA30 gene promoter, potentially acting as a molecular link between an auxin signaling developmental feedback loop and a salt signal transduction pathway during seed germination.
Gene References Into Functions
The function of ANAC069 is supported by the following research findings:
  1. ANAC069 regulates gene expression primarily through interaction with the DNA sequence C[A/G]CG[T/G] in response to abiotic stresses. PMID: 27975189
  2. ATDOF5.8 regulates ANAC069 expression. PMID: 25572919
  3. NTM2 integrates auxin signaling into salt stress signaling during seed germination. PMID: 21757997
  4. Auxin delays seed germination under high salinity through crosstalk with NTM2-mediated salt signaling in Arabidopsis. PMID: 21450938
Database Links

KEGG: ath:AT4G01550

STRING: 3702.AT4G01550.1

UniGene: At.34408

Subcellular Location
Membrane; Single-pass membrane protein. Nucleus.

Q&A

What is the basic structure of Arabidopsis thaliana NAC69 protein?

NAC69 (also known as NTM2 or ANAC069) is a membrane-bound NAC transcription factor consisting of 457 amino acid residues. Its structure includes:

  • A highly conserved NAC DNA-binding domain at the N-terminus (divided into five sub-domains A-E)

  • A divergent C-terminal region

  • A transmembrane (TM) motif in the far C-terminal region that anchors the protein to the plasma membrane

The NAC domain functions in nuclear localization, DNA binding, and facilitates the formation of homodimers or heterodimers with other NAC domain-containing proteins . The C-terminal region operates as a functional domain that can act as a transcriptional activator or repressor .

How does the NAC69 protein localize within plant cells, and what methodologies can confirm this localization?

NAC69/NTM2 is a plasma membrane-bound transcription factor under normal conditions but can be released and translocated to the nucleus under stress conditions. This subcellular localization can be confirmed through:

Methodological approach:

  • GFP fusion constructs: Creating GFP-NTM2 gene fusions and transiently expressing them in Arabidopsis protoplasts

  • Fluorescence microscopy: Observing localization patterns under different conditions

  • Cell fractionation: Separating membrane and nuclear fractions followed by Western blotting

Research findings show that the full-size NTM2 protein localizes to the plasma membrane, while truncated forms lacking the transmembrane domain (ΔC form) localize predominantly in the nucleus . Under high salinity conditions, a significant portion of the full-length protein is detected in the nucleus, indicating stress-induced proteolytic release from the membrane .

What are the expression patterns of NAC69 in different Arabidopsis tissues?

NAC69/NTM2 shows distinct tissue-specific expression patterns:

TissueExpression LevelInduction by Salt
RootsModerate baseline, high when induced~8-fold increase
ShootsLow to moderateMinimal change
Germinating seedsLow under normal conditionsHighly induced in emerging radicle
InflorescencePresentNot specified

The expression is particularly pronounced in roots when exposed to salt stress. Histochemical analysis using promoter-GUS fusions confirms that while GUS activity was uninfluenced by high salinity in leaves, it was elevated significantly in the roots . This tissue-specific expression pattern suggests specialized roles in root-mediated stress responses.

How is NAC69 expression regulated in response to different abiotic stresses?

NAC69/NTM2 expression responds differentially to various abiotic stresses:

Stress ConditionExpression ResponseTissue Specificity
High Salinity (NaCl)Strongly inducedPrimarily in roots (~8-fold)
ABA TreatmentInducedParticularly in roots
DehydrationInducedSimilar pattern to ABA response
Cold StressMinimal changeNot significantly responsive

Methodologically, these responses can be measured using:

  • Quantitative real-time PCR (qRT-PCR) from tissues exposed to different stresses

  • Promoter-reporter gene fusion assays (e.g., pNTM2-GUS constructs)

  • RNA-sequencing to detect genome-wide expression changes

The salt induction of NAC69/NTM2 occurs even in the ABA-insensitive mutant abi2-1, suggesting the salt response pathway is at least partially independent of ABA signaling .

What post-translational modifications regulate NAC69/NTM2 activity?

NAC69/NTM2 activity is primarily regulated through proteolytic processing:

Methodological insights:

  • The membrane-bound full-length NAC69/NTM2 is inactive as a transcription factor when attached to the plasma membrane

  • Stress conditions (particularly high salinity) trigger proteolytic release of the protein from the membrane

  • The released N-terminal portion containing the NAC domain translocates to the nucleus and acts as a transcriptional activator

Evidence shows that while transgenic plants overexpressing the full-size NTM2 form (35S:NTM2) show no discernible phenotypes, those overexpressing the truncated ΔC form (lacking the transmembrane domain) exhibit a dwarfed appearance with small, curled leaves . This indicates that membrane release is essential for its transcriptional activity.

Experimental approaches to study this regulation include:

  • Creating truncated protein variants (ΔTM and ΔC constructs)

  • Transcriptional activation assays using GAL4 transient expression systems

  • GFP-fusion protein localization studies before and after stress treatments

What is the role of NAC69/NTM2 in salt stress responses during seed germination?

NAC69/NTM2 functions as a negative regulator of seed germination under high salinity conditions:

Methodological findings:

  • Knockout mutant analysis: The ntm2-1 mutant seeds exhibit enhanced resistance to high salinity during germination. When germinated on media containing 150 mM NaCl, control seed germination was reduced by ~70%, while ntm2-1 seed germination was only reduced by ~40% .

  • Complementation studies: The salt-resistant germination phenotype disappears in ntm2-1 mutants complemented with a wild-type NTM2 gene, confirming the specific role of this protein .

  • Expression analysis: NAC69/NTM2 is highly induced in the emerging radicle under high salinity conditions during germination, as shown by promoter-GUS fusion studies .

  • Mechanistic pathway: NAC69/NTM2 integrates salt and auxin signals by regulating the expression of IAA30, which acts as a negative regulator of germination under salt stress .

The function is specific to salt stress, as germination of ntm2-1 seeds responded normally to ABA and the GA biosynthetic inhibitor paclobutrazol, indicating the NTM2-mediated salt signaling in germination is independent of these classical germination-regulating hormones .

How does NAC69/NTM2 interact with auxin signaling pathways?

NAC69/NTM2 serves as a molecular integrator between salt and auxin signaling pathways:

Experimental evidence and mechanisms:

The signaling model proposes that high salinity triggers NTM2 processing and release from the membrane, allowing it to activate IAA30 expression, which then mediates the inhibitory effects of auxin on germination under salt stress conditions .

What other biological processes does NAC69/ANAC096 regulate in Arabidopsis?

Beyond salt stress and germination, NAC69 (also known as ANAC096) regulates several other important biological processes:

  • Dehydration and osmotic stress responses:

    • ANAC096 cooperates with bZIP-type transcription factors (ABF/AREB) to help plants survive under dehydration and osmotic stress

    • The anac096 mutant shows impaired ABA-induced stomatal closure and increased water loss under dehydration stress

  • ABA-responsive gene regulation:

    • Genome-wide expression analysis reveals that a major proportion of ABA-responsive genes are under transcriptional regulation by ANAC096

    • ANAC096 and ABF2 synergistically activate RD29A transcription

  • Protein interactions:

    • ANAC096 directly interacts with ABF2 and ABF4 (but not ABF3) both in vitro and in vivo

    • The anac096 abf2 abf4 triple mutant shows much greater sensitivity to dehydration and osmotic stresses than the single or double mutants, demonstrating their synergistic relationship

The experimental evidence suggests that NAC69/ANAC096 functions in multiple stress response pathways through both transcriptional regulation and protein-protein interactions with other transcription factors.

What are the most effective methods for producing recombinant NAC69 protein?

Recombinant production of NAC69 can be achieved through several approaches:

E. coli expression system (most common):

  • Full-length protein expression:

    • Clone the complete coding sequence (1-457aa) with an N-terminal His tag

    • Express in E. coli

    • Purify using affinity chromatography

    • Store as lyophilized powder in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

  • Truncated protein expression (for functional studies):

    • ΔTM construct (residues 1-420) lacking the transmembrane motif

    • ΔC construct (residues 1-287) similar to transcriptionally active nuclear forms

    • Express as MBP (maltose-binding protein) fusion for higher solubility

Reconstitution protocol:

  • Briefly centrifuge vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃

Storage recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

What methods can be used to study NAC69 transcriptional activity and target genes?

Several complementary approaches can be used to investigate NAC69 transcriptional activity:

  • Transient expression assays in protoplasts:

    • GAL4 transient expression system: Fuse NAC domains to GAL4 DNA-binding domains

    • Co-transform with reporter vectors containing GUS reporter genes

    • Normalize with Renilla luciferase

    • Measure transcriptional activation capabilities of different protein variants

  • DNA-binding studies:

    • Electrophoretic mobility shift assays (EMSA) using recombinant protein

    • Identify binding motifs in target gene promoters

    • Use unlabeled competitor DNA and mutated sequences to verify specificity

  • Chromatin immunoprecipitation (ChIP):

    • Create tagged versions of NAC69 for immunoprecipitation

    • Identify genome-wide binding sites or validate specific targets

    • Correlate binding with transcriptional changes

  • Gene expression analysis in mutants:

    • Compare transcript levels of potential target genes in wild-type vs. ntm2-1 mutants

    • Use quantitative real-time PCR (qRT-PCR) or RNA-seq approaches

    • Analyze expression under different stress conditions

  • Promoter-reporter fusion assays:

    • Create constructs with target gene promoters fused to reporter genes

    • Test activation in the presence of wild-type or modified NAC69 proteins

    • Analyze in planta or in transient expression systems

Research has identified IAA30 as a direct target gene of NAC69/NTM2. The protein binds to a conserved sequence in the IAA30 promoter and activates its expression, particularly under salt stress conditions .

How can researchers generate and characterize NAC69 mutant lines in Arabidopsis?

Generating and characterizing NAC69 mutant lines involves several methodological approaches:

  • Obtaining existing mutant lines:

    • T-DNA or transposon insertion lines from stock centers:

      • ntm2-1 (CSHL-ET8732) - transposon insertional knockout from Arabidopsis Genetrap Database

      • anac096-1 and anac096-2 (SALK_078797C) - T-DNA insertion lines

    • Verify homozygosity through PCR genotyping

  • Creating new mutant or transgenic lines:

    • CRISPR/Cas9 gene editing for precise mutations

    • RNA interference (RNAi) for gene silencing

    • Overexpression constructs:

      • Full-length protein (35S:NTM2)

      • Truncated versions lacking transmembrane domain (35S:ΔTM)

      • Constitutively active nuclear form (35S:ΔC)

  • Complementation analysis:

    • Transform mutants with wild-type gene under native promoter (pNTM2-NTM2)

    • Verify restoration of normal phenotype

  • Phenotypic characterization:

    • Germination assays:

      • Imbibe seeds on MS-agar plates at 4°C for 3 days

      • Allow germination at 22°C under long days

      • Count emergence of visible radicle as marker for germination

      • Test effects of NaCl (50-150 mM), ABA, IAA, or PAC

    • Stress response assays:

      • Seedling growth under salt stress

      • Primary root growth measurements

      • Dehydration tolerance

      • ABA sensitivity tests

  • Molecular characterization:

    • Verify absence of transcript using RT-PCR

    • Analyze expression of downstream genes

    • Examine protein localization using GFP fusions

For advanced studies, researchers have created double and triple mutants by crossing NAC69/ANAC096 mutants with mutants of interacting partners like ABF2 and ABF4 to study their genetic interactions .

How does NAC69 function differ from other membrane-bound NAC transcription factors?

NAC69/NTM2 exhibits both similarities and differences when compared to other membrane-bound NAC transcription factors:

Similarities with other membrane-bound NACs:

  • Structural organization: Like NTM1, NTL6, and NTL8, NAC69/NTM2 contains a NAC domain at the N-terminus and a transmembrane motif at the C-terminus

  • Activation mechanism: Undergoes proteolytic release from the membrane to become active, similar to other membrane-bound NACs

  • Stress responsive: Responds to environmental stresses, a common feature of many NAC transcription factors

Distinctive features of NAC69/NTM2:

  • Phenotypic effects: Overexpression of the active ΔC form results in dwarfed appearance with small, curled leaves, but notably without leaf serration seen in NTM1 overexpression lines

  • Specific signaling pathway: Uniquely integrates auxin and salt signals during seed germination through regulation of IAA30

  • Tissue specificity: Shows distinctive expression patterns with predominant induction in roots under salt stress

  • Target genes: Regulates a specific set of target genes different from other NACs, including auxin-related genes like IAA30, IAA11, IAA19, and GH3.4

When comparing NTM1 (At4G01540) and NTM2/NAC69 (At4G01550), which are adjacent loci with high sequence homology, their functions differ significantly:

  • NTM1 regulates cell division by modulating cytokinin signaling

  • NTM2/NAC69 integrates auxin and salt signals during seed germination

These differences highlight the functional diversification among structurally similar NAC transcription factors, suggesting their evolution to regulate distinct physiological processes.

What methodologies are most effective for studying the interplay between NAC69 and other transcription factors?

Investigating the interplay between NAC69 and other transcription factors requires sophisticated approaches:

  • Protein-protein interaction studies:

    • Yeast two-hybrid (Y2H): Screen for potential interacting partners

    • Bimolecular fluorescence complementation (BiFC): Visualize interactions in planta

    • Co-immunoprecipitation (Co-IP): Confirm interactions in native conditions

    • FRET/FLIM analyses: Study dynamic interactions in living cells

  • Transcriptional cooperation analysis:

    • Dual-luciferase reporter assays: Measure synergistic activation of promoters

    • Chromatin immunoprecipitation sequencing (ChIP-seq): Identify co-occupied genomic regions

    • DNA affinity purification sequencing (DAP-seq): Define binding motifs and preferences

  • Genetic interaction studies:

    • Creation of higher-order mutants: Generate double/triple mutants (e.g., anac096 abf2 abf4)

    • Phenotypic analysis: Compare single vs. combined mutant phenotypes

    • Epistasis tests: Determine hierarchy in signaling pathways

Research findings demonstrate that ANAC096 physically interacts with ABF2 and ABF4 but not with ABF3 . This selective interaction results in synergistic activation of stress-responsive genes like RD29A. The anac096 abf2 abf4 triple mutant shows much greater sensitivity to dehydration and osmotic stresses than single or double mutants, providing genetic evidence for their functional cooperation .

For NAC69/NTM2's interaction with auxin signaling, techniques such as comparing gene expression patterns between wild-type and ntm2-1 mutants under various conditions, combined with DNA-binding studies of auxin-responsive gene promoters (like IAA30), have revealed important functional connections .

How can NAC69 be exploited for improving crop stress tolerance?

Translating NAC69 research into crop improvement strategies involves several methodological approaches:

  • Genetic engineering strategies:

    • Transgenic overexpression:

      • Constitutive expression using strong promoters (potential drawbacks: growth penalties)

      • Stress-inducible expression using specific promoters (more targeted approach)

      • Expression of truncated, constitutively active forms lacking the transmembrane domain

    • CRISPR/Cas9 gene editing:

      • Modifying the transmembrane domain for altered membrane release dynamics

      • Engineering promoter regions to enhance stress responsiveness

      • Creating alleles with altered binding properties or protein-protein interactions

  • Target crop selection considerations:

    • Focus on crops with conserved NAC69 homologs

    • Prioritize species where salt stress significantly impacts germination and early growth

    • Consider species-specific differences in auxin-salt interactions

  • Performance evaluation methodology:

    • Controlled stress tests (germination under different salt concentrations)

    • Field trials in saline environments

    • Comprehensive phenotyping (germination rate, biomass, yield components)

    • Molecular analysis of stress-responsive gene networks

  • Potential trade-offs to monitor:

    • Growth-defense balance (energy allocation)

    • Altered auxin responses affecting development

    • Changes in other stress response pathways

Research findings indicate that while NAC69/NTM2 is a negative regulator of germination under salt stress, its role in integrating auxin and salt signals provides multiple potential intervention points . Engineering crops with modified NAC69 activity or altered downstream components (like IAA30) could potentially enhance germination and seedling establishment under saline conditions.

For application in crop stress tolerance, researchers should consider the synergistic relationships between NAC69/ANAC096 and other transcription factors (like ABF/AREB family members) that together regulate comprehensive stress response networks .

What are the gaps in understanding the complete protein interaction network of NAC69?

Despite significant progress in NAC69 research, several knowledge gaps remain regarding its protein interaction network:

  • Unknown proteolytic mechanism:

    • The specific proteases responsible for NAC69/NTM2 release from the membrane remain unidentified

    • Research question: Are calpain or metalloprotease-like activities involved in NTM2 processing, similar to other membrane-bound NACs?

    • Methodological approach: Protease inhibitor studies, in vitro proteolytic assays, identification of cleavage sites

  • Incomplete protein interaction map:

    • While interaction with the IAA30 promoter is established, direct protein interactors are largely unknown

    • Research question: Does NAC69 form heterodimers with other NAC proteins or interact with additional transcription factor families?

    • Methodological approach: Systematic yeast two-hybrid screens, co-immunoprecipitation followed by mass spectrometry

  • Regulatory protein modifications:

    • Post-translational modifications beyond proteolytic cleavage are unexplored

    • Research question: Do phosphorylation, SUMOylation, or other modifications regulate NAC69 activity?

    • Methodological approach: Phosphoproteomic analysis, site-directed mutagenesis of potential modification sites

  • Interaction with chromatin-modifying complexes:

    • The potential recruitment of histone modifiers or chromatin remodelers is unknown

    • Research question: Does NAC69 interact with epigenetic regulators to control gene expression?

    • Methodological approach: ChIP-seq for histone modifications at NAC69 target genes, protein complex isolation

Current methodological challenges include developing tools to study the dynamic process of membrane release and nuclear translocation in real-time in living cells, as well as distinguishing between direct and indirect target genes in stress response networks.

How does the genetic variation in NAC69 contribute to natural variation in stress responses across Arabidopsis accessions?

Understanding how natural variation in NAC69 contributes to different stress response phenotypes is an emerging research frontier:

  • Sequence polymorphism analysis:

    • NAC69 may contain genetic variations across Arabidopsis accessions

    • Research question: Do SNPs or structural variations in NAC69 correlate with altered stress tolerance?

    • Methodological approach: Sequence NAC69 across ecotypes, correlate with phenotypic data, perform association studies

  • Expression variation:

    • Differences in NAC69 expression levels or patterns might exist between accessions

    • Research question: Is differential expression of NAC69 associated with ecological adaptation to saline environments?

    • Methodological approach: Expression QTL (eQTL) analysis, promoter sequence comparison, expression studies across diverse accessions

  • Interaction with genetic background:

    • The effect of NAC69 variants may depend on other genetic factors

    • Research question: Do genetic interactions between NAC69 and other loci create accession-specific stress response networks?

    • Methodological approach: Create NILs (Near Isogenic Lines) with different NAC69 alleles, analyze epistatic interactions

Related research on Arabidopsis transposable elements shows extensive variation between accessions in relation to climate and genetic factors . Similar approaches could be applied to study NAC transcription factor variation across populations.

Preliminary evidence from virus response studies in Arabidopsis has shown that genetic variation contributes to different disease-related traits, with strong associations detected on chromosome 2 . Similar methodologies could be applied to study NAC69 natural variation in stress responses.

What new technologies could advance our understanding of NAC69 function and regulation?

Emerging technologies that could significantly advance NAC69 research include:

  • Single-cell approaches:

    • Single-cell RNA-seq: Resolve cell-type specific expression patterns in complex tissues

    • Single-cell proteomics: Detect protein levels and modifications at cellular resolution

    • Research application: Map NAC69 activity in specific cell types during stress responses

  • Advanced imaging technologies:

    • Live-cell super-resolution microscopy: Track NAC69 membrane release and nuclear translocation in real-time

    • Single-molecule tracking: Monitor the dynamics of individual NAC69 molecules

    • FRAP/photoconvertible fluorophores: Measure protein movement between cellular compartments

    • Research application: Visualize the kinetics of stress-induced NAC69 activation

  • CRISPR-based technologies:

    • CRISPRa/CRISPRi: Modulate NAC69 expression with temporal precision

    • Base editing/prime editing: Create specific NAC69 variants without double-strand breaks

    • CRISPR screens: Identify genes affecting NAC69 processing or activity

    • Research application: Create precise mutations in functional domains to dissect protein function

  • Structural biology advances:

    • Cryo-EM: Determine the structure of NAC69 complexes with DNA or other proteins

    • AlphaFold2/RoseTTAFold: Predict structural changes due to mutations or interactions

    • Research application: Understand the structural basis of NAC69's selective interactions and DNA-binding specificity

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, metabolomics, and phenomics data

    • Machine learning approaches to identify patterns in complex datasets

    • Research application: Build comprehensive models of NAC69-mediated stress response networks

These technologies would help address fundamental questions about NAC69, such as the precise mechanism of membrane release, the complete set of direct target genes, and the dynamic interaction with other signaling pathways during stress responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.