Recombinant Arabidopsis thaliana NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana NADH-ubiquinone Oxidoreductase Chain 3 (ND3)

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a subunit of Complex I (NADH:ubiquinone oxidoreductase), an enzyme located in the mitochondrial inner membrane . Complex I, the largest of the five complexes, is crucial for the mitochondrial respiratory chain .

Functional Role in Arabidopsis thaliana

In Arabidopsis thaliana, as in other organisms, ND3 is essential for the function of Complex I, which catalyzes NADH dehydrogenation and electron transfer to ubiquinone (coenzyme Q10) . The process begins with NADH binding to Complex I, which then transfers two electrons to the flavin mononucleotide (FMN) to form FMNH2 . Subsequently, electrons move through iron-sulfur clusters to coenzyme Q10, reducing it to ubiquinol (CoQH2) . This electron flow induces a conformational change, pumping four hydrogen ions out of the mitochondrial matrix .

ND3 and Complex I Deficiency

Complex I deficiency is the most frequent cause of mitochondrial respiratory chain defects . Research shows that the absence of ND3 prevents the assembly of the 950-kDa Complex I and suppresses enzyme activity . Introducing alternative NADH dehydrogenases (NDH-2) from Arabidopsis thaliana can rescue Complex I deficiency under certain conditions .

Alternative Dehydrogenases and Complex I Rescue

Arabidopsis thaliana expresses different isoforms of NDH-2, which are associated with either the inner or outer mitochondrial membrane . These alternative systems maintain redox balance and turnover of mitochondrial metabolism, oxidizing substrates when Complex I is metabolically inactive . NDH-2 activity is stimulated when electron flux through mitochondrial OXPHOS slows down .

Biotechnological Applications and Study of Urea Transporters

Arabidopsis thaliana is also used in studies of urea transport. For example, the Arabidopsis DUR3 gene (AtDUR3) encodes a high-affinity urea transporter located on the plasma membrane . Structural analysis has clarified how urea is specifically recognized and transported .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; AtMg00990; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ND3
Target Protein Sequence
MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIR FYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana NADH-ubiquinone oxidoreductase chain 3 (ND3): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does ND3 contribute to Complex I structure and function in Arabidopsis?

ND3 is one of the core hydrophobic subunits of mitochondrial Complex I (NADH:ubiquinone oxidoreductase), which is the largest enzyme complex in the respiratory chain. Research with other organisms has shown that absence of ND3 prevents the assembly of the entire 950-kDa Complex I and suppresses enzymatic activity . In Arabidopsis, ND3 is embedded in the membrane arm of Complex I, which anchors the complex to the inner mitochondrial membrane. While the precise function of hydrophobic subunits like ND3 remains unclear, they are essential for the structural integrity of Complex I and likely participate in proton pumping across the inner mitochondrial membrane, a critical function for cellular energy production .

What expression systems are most effective for producing recombinant Arabidopsis thaliana ND3?

For recombinant expression of hydrophobic membrane proteins like ND3, specialized expression systems are required. Bacterial systems like modified E. coli strains (C41/C43) containing additional membrane structures or cell-free expression systems supplemented with lipids or detergents often provide better results than conventional expression systems. For plant membrane proteins like Arabidopsis ND3, plant-based expression systems such as Nicotiana benthamiana transient expression can offer proper folding and post-translational modifications. When designing expression constructs, including purification tags that don't interfere with protein folding is essential, with C-terminal tags generally being preferable for membrane proteins to avoid disrupting signal sequences or transmembrane domain insertions.

What are the optimal conditions for solubilizing and purifying recombinant Arabidopsis ND3?

The purification of hydrophobic membrane proteins like ND3 requires careful optimization. For initial solubilization, mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin are recommended to maintain protein structure and function. The solubilization buffer should contain stabilizing agents like glycerol (10-15%) and appropriate salt concentrations (typically 150-300 mM NaCl). Purification is commonly achieved through affinity chromatography using tags such as polyhistidine, followed by size exclusion chromatography to improve purity.

Temperature control during purification is critical, with all steps ideally performed at 4°C to prevent protein degradation. For long-term storage, incorporating the protein into nanodiscs or liposomes can help maintain its native conformation and functional properties better than detergent micelles alone.

How can researchers verify the functional integrity of recombinant ND3 after purification?

Functional assessment of recombinant ND3 involves multiple complementary approaches:

  • Enzymatic activity assays: NADH oxidation can be measured spectrophotometrically by monitoring absorbance changes at 340 nm.

  • Structural integrity analysis: Circular dichroism (CD) spectroscopy to assess secondary structure elements characteristic of membrane proteins.

  • Protein-protein interaction studies: Co-immunoprecipitation with other Complex I components to verify proper association.

  • Liposome reconstitution: Incorporation of ND3 into liposomes followed by proton pumping assays to assess functionality.

  • Complementation experiments: Expression of recombinant ND3 in Arabidopsis lines with mutated endogenous ND3 to assess rescue of phenotype.

These techniques provide comprehensive information about both structural integrity and functional capacity of the recombinant protein.

What expression vectors and tags are recommended for recombinant Arabidopsis thaliana ND3 production?

For successful expression of recombinant Arabidopsis ND3, vector selection should prioritize those containing strong inducible promoters like pER8 that have been successfully used in Arabidopsis expression systems . The estradiol-inducible system (pER8) allows for controlled expression, which is particularly useful when studying potentially toxic membrane proteins . For purification purposes, a C-terminal polyhistidine tag (6-8 histidines) is often optimal, as it typically causes minimal interference with protein folding and insertion into membranes.

For in vivo localization studies, fluorescent protein fusions with monomeric variants like mCherry or mVenus can be employed, though care must be taken as these may affect the folding of hydrophobic proteins. When protein-protein interactions are of interest, split-tag systems or BioID proximity labeling approaches can be incorporated into the vector design.

How does the nuclear export of ribosomes affect ND3 translation and Complex I assembly in Arabidopsis?

The nuclear export of ribosomes, particularly the 60S ribosomal subunit, plays a crucial role in the translation of mitochondrial-encoded proteins like ND3. In Arabidopsis, NMD3 is a critical factor required for the nuclear export of the 60S ribosomal subunit, similar to its function in yeast and vertebrates . Disruption of this export process through dominant negative interference with AtNMD3 results in the retention of 60S ribosomal subunits in the nucleus .

This interference has far-reaching consequences, including a significant decrease in rough endoplasmic reticulum (RER) in plant cells . Since RER is essential for membrane protein synthesis, disrupted ribosome export potentially affects the translation of nuclear-encoded components of Complex I, creating an imbalance between nuclear and mitochondrial-encoded subunits. This imbalance may impair Complex I assembly even when mitochondrial ND3 translation remains intact. Research suggests that proper coordination between cytoplasmic protein synthesis and nuclear transcription is vital for cellular processes including respiratory complex assembly .

What analytical techniques are most informative for studying ND3 interactions with other Complex I subunits?

Understanding the interactions between ND3 and other Complex I subunits requires sophisticated analytical approaches:

  • Cryo-electron microscopy (cryo-EM) provides high-resolution structural information about membrane protein complexes without crystallization.

  • Crosslinking mass spectrometry (XL-MS) identifies interaction interfaces between ND3 and neighboring subunits by creating covalent links between closely positioned amino acids.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) reveals protected regions in the protein structure, indicating interaction sites.

  • Native mass spectrometry maintains protein complexes intact during analysis, providing information about complex composition and stability.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) can quantify binding affinities between ND3 and other purified Complex I components.

Combining these complementary techniques creates a comprehensive map of ND3's interaction network within Complex I.

How do mutations in Arabidopsis ND3 affect plant growth and stress responses compared to mutations in nuclear-encoded Complex I subunits?

Mutations in mitochondrially-encoded subunits like ND3 typically produce distinct phenotypes compared to mutations in nuclear-encoded Complex I components. While specific data for Arabidopsis ND3 mutants is limited in the provided search results, research on related mitochondrial respiratory components provides some insights.

Disruption of mitochondrial genes often leads to more severe phenotypes than comparable nuclear gene mutations because mitochondrial DNA has limited repair mechanisms. Plants with ND3 mutations may exhibit:

  • Reduced growth and biomass accumulation due to compromised ATP production

  • Altered leaf morphology and root development

  • Increased susceptibility to environmental stressors, particularly heat and drought

  • Activated alternative respiratory pathways as compensation mechanisms

  • Reduced secondary cell wall formation, similar to effects observed with disrupted ribosome export

Interestingly, plants with defects in Complex I often show activation of alternative NADH dehydrogenases and increased expression of stress-responsive genes, suggesting complex cellular adaptations to mitochondrial dysfunction.

What is the role of ND3 in coordinating nuclear and mitochondrial gene expression in Arabidopsis?

Research suggests that mitochondrial Complex I components like ND3 participate in retrograde signaling pathways that coordinate nuclear and mitochondrial gene expression. When Complex I assembly is disrupted, either through ND3 mutations or absence, specific signaling cascades are activated that influence nuclear gene expression patterns. This communication is essential for maintaining proper stoichiometry between nuclear-encoded and mitochondrially-encoded respiratory complex components.

The mechanisms may involve:

  • Reactive oxygen species (ROS) generated by dysfunctional electron transport

  • Altered NAD+/NADH ratios affecting cellular redox state

  • Changes in mitochondrial membrane potential

  • Accumulation of specific metabolic intermediates that act as signaling molecules

This retrograde signaling ensures coordinated expression of the approximately 40 subunits that comprise Complex I in plants, many of which are encoded in the nucleus .

How does the structure and function of Arabidopsis ND3 compare to that in other model organisms?

Arabidopsis ND3, like its counterparts in other organisms, is a hydrophobic subunit of Complex I embedded in the membrane arm. Comparative analysis reveals both conservation and divergence:

OrganismGenome LocationProtein SizeComplex I SizeNotable Features
Arabidopsis thalianaMitochondrial~14 kDa~1000 kDaPart of L-shaped complex
Chlamydomonas reinhardtiiNuclear (NUO3 gene)~12 kDa~950 kDaNuclear relocalization
Bos taurus (Mammal)Mitochondrial~13 kDa~980 kDa (46 subunits)Well-characterized structure
Neurospora crassa (Fungus)Mitochondrial~13 kDa~940 kDa (39 subunits)Important model for assembly

The nuclear encoding of ND3 in Chlamydomonas is particularly interesting, as it demonstrates decreased hydrophobicity compared to mitochondrially-encoded counterparts, facilitating import into mitochondria . This evolutionary adaptation illustrates the dynamic nature of the mitochondrial and nuclear genomes throughout evolution.

What methodological approaches are used to study the effects of ND3 mutations on Complex I assembly and activity in Arabidopsis?

Researchers employ various techniques to investigate how ND3 mutations affect Complex I:

  • Blue-native polyacrylamide gel electrophoresis (BN-PAGE) to visualize intact respiratory complexes and assess assembly status.

  • In-gel activity assays using NADH and electron acceptors like nitrotetrazolium blue (NBT) to visualize enzymatic activity directly in gels.

  • Oxygen consumption measurements using Clark-type electrodes or Seahorse analyzers to assess respiratory capacity in isolated mitochondria or intact tissues.

  • Proteomic analysis of Complex I composition using mass spectrometry to identify missing or altered subunits.

  • Electron microscopy to visualize structural changes in mitochondrial ultrastructure.

  • RNA interference (RNAi) or CRISPR-Cas9 approaches to generate controlled ND3 mutations or expression variations for phenotypic analysis .

Each method provides complementary information about how ND3 contributes to Complex I structure and function.

How can understanding Arabidopsis ND3 contribute to crop improvement strategies?

Research on Arabidopsis ND3 and Complex I has translational implications for crop improvement:

  • Energy efficiency optimization: Knowledge of ND3's role in respiratory efficiency could guide breeding for crops with improved energy utilization and biomass production.

  • Stress tolerance enhancement: Since mitochondrial function is crucial during stress responses, understanding how ND3 mutations affect stress resistance could inform strategies for developing more resilient crops.

  • Metabolic engineering: Insights from Arabidopsis Complex I research facilitate rational design of metabolic pathways in crops to enhance desired traits.

  • Gene editing applications: CRISPR-Cas9 technology can potentially be used to modify specific regions of ND3 or its interacting partners to achieve desirable phenotypes in crops, based on knowledge gained from Arabidopsis studies .

  • Hybrid vigor mechanisms: Mitochondrial-nuclear interactions, including those involving ND3, may contribute to hybrid vigor, a phenomenon exploited in agriculture .

The value of Arabidopsis as a model is evident in numerous successful applications of foundational discoveries to crop improvement, as documented in translational research studies .

What experimental approaches can distinguish between direct effects of ND3 mutations and secondary metabolic adaptations?

Distinguishing primary from secondary effects of ND3 mutations requires sophisticated experimental designs:

  • Time-course experiments: Analyzing changes immediately following controlled induction of ND3 mutations versus long-term adaptations.

  • Conditional expression systems: Using estradiol-inducible systems like pER8 to control ND3 expression levels precisely .

  • Metabolomic profiling: Comprehensive analysis of metabolite changes using techniques like GC-MS and LC-MS to identify shifted metabolic pathways.

  • Transcriptomic analysis: RNA-Seq to identify changes in gene expression patterns that represent compensatory responses.

  • Flux analysis using stable isotopes: Tracing carbon and nitrogen fluxes through metabolic pathways to quantify redirected metabolic flows.

  • Pharmacological approaches: Using specific inhibitors to block compensatory pathways and isolate direct effects of ND3 dysfunction.

The integration of these approaches can create a temporal map distinguishing immediate consequences of ND3 dysfunction from adaptive responses.

How does IAA biosynthesis relate to mitochondrial function and ND3 activity in Arabidopsis?

The relationship between auxin (IAA) biosynthesis and mitochondrial function, including ND3 activity, represents an intriguing area of research. Plant hormones like auxin regulate numerous developmental processes, and their biosynthesis is energy-dependent. In Arabidopsis, the main auxin biosynthesis pathway involves TAA1 and YUC family enzymes, as evidenced by increased IAA and IAA-Glu levels in TAA1ox YUC6ox double overexpression lines .

PlantsIAA (ng/gfw)IAA-Asp (ng/gfw)IAA-Glu (ng/gfw)
pER820.6 ± 1.7ND1.2 ± 0.5
TAA1ox29.6 ± 2.1*ND1.1 ± 0.4
yuc1D25.3 ± 3.4ND8.1 ± 1.6*
TAA1ox yuc1D37.2 ± 4.0*ND18.7 ± 5.0*, †
YUC6ox27.5 ± 2.0*61.8 ± 1628.9 ± 4.2*
TAA1ox YUC6ox50.7 ± 2.0*, †5,930 ± 175 †657 ± 125*, †

Mitochondrial function, including proper activity of Complex I components like ND3, is essential for providing ATP and reducing equivalents for biosynthetic pathways. Disruptions in mitochondrial function through ND3 mutations likely affect auxin biosynthesis and metabolism, potentially contributing to developmental phenotypes observed in respiratory mutants. This connection highlights the integrated nature of energy metabolism and hormone signaling in plants.

What are the most promising techniques for studying ND3 dynamics in living plant cells?

Emerging technologies provide unprecedented opportunities for studying ND3 dynamics in vivo:

  • In vivo labeling with minimally disruptive tags or split fluorescent proteins that can assemble when adjacent proteins interact.

  • Super-resolution microscopy techniques like STED or PALM that can visualize mitochondrial substructures beyond the diffraction limit.

  • CRISPR-based imaging using catalytically inactive Cas proteins fused to fluorophores for targeting specific mtDNA regions encoding ND3.

  • Optogenetic tools to control ND3 expression or activity with light, allowing precise temporal control.

  • Single-molecule tracking to follow individual Complex I assemblies containing tagged ND3 in mitochondrial membranes.

These advances will enable researchers to address fundamental questions about ND3 dynamics, assembly pathways, and responses to environmental changes in living cells.

How can systems biology approaches integrate ND3 function into broader cellular networks in Arabidopsis?

Systems biology offers powerful frameworks for understanding ND3's role within cellular networks:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from ND3 mutants to build comprehensive network models.

  • Flux balance analysis: Mathematical modeling of metabolic networks to predict how ND3 dysfunction ripples through primary and secondary metabolism.

  • Protein-protein interaction networks: Mapping the interactome of ND3 beyond Complex I to identify unexpected functional connections.

  • Machine learning approaches: Using AI to identify patterns in large datasets that may reveal novel regulatory connections involving ND3.

  • Comparative systems biology: Analyzing equivalent networks across multiple species to identify conserved and divergent features of ND3 regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.