Recombinant Arabidopsis thaliana NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; AtCg01080; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ndhG
Target Protein Sequence
MDLPGPIHDFLLVFLGSGLLVGGLGVVLLPNPIFSAFSLGFVLVCISLLYILSNSHFVAA AQLLIYVGAINVLIIFAVMFMNDSEYSTDFNLWTIGNGITSLVCTTILFLLMSTILDTSW YGVIWTTKLNQILEQDLISNSQQIGIHLSTDFFLPFELISIILLVALIGAISVARQ
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and possibly in a chloroplast respiratory chain. In this species, plastoquinone is considered the immediate electron acceptor for the enzyme. NDH couples the redox reaction to proton translocation, thereby conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of ndhG in Arabidopsis thaliana?

ndhG is a chloroplastic gene that encodes a subunit of the NAD(P)H dehydrogenase-like (NDH) complex in Arabidopsis thaliana. This complex plays a critical role in redirecting electrons from ferredoxin to the plastoquinone pool, while simultaneously pumping protons from the stroma into the lumen. Within the NDH complex, ndhG specifically serves as one of the proton pumps. The NDH complex enables cyclic electron transport (CET) around Photosystem I (PSI), where electrons from the plastoquinol pool can be transferred via cytochrome b6f, plastocyanin, and the reaction center of PSI to ferredoxin, completing the cycle .

How is NDH activity measured in experimental settings?

NDH activity is typically measured via the post-illumination fluorescence rise. While traditionally this method was implemented using non-imaging chlorophyll fluorometers, it can now be incorporated into high-throughput chlorophyll fluorescence imaging protocols. The validity of this approach can be confirmed using knockout mutants of nuclear NDH genes, such as ndho and ndhm, which show a complete absence of the post-illumination fluorescence rise compared to wild-type plants (e.g., Col-0) that display this characteristic response. This method allows researchers to quantify relative differences in NDH activity between different genotypes or under varying environmental conditions .

What is the evolutionary significance of ndhG conservation?

The ndhG gene shows remarkable evolutionary conservation, particularly at the N-terminus, with the Ile7 amino acid position being conserved since the common ancestor with cycads and ferns. This high degree of conservation, despite the fact that some plant lineages (certain orchids and gymnosperms) have lost genes encoding components of the NDH complex, suggests important functional constraints on ndhG. The persistence of 29 genes related to the NDH complex across most plant families further underlines this evolutionary constraint. The conservation appears to be related to significant impacts on plant performance, particularly under fluctuating light conditions .

How should experiments be designed to study ndhG allelic variants?

When studying ndhG allelic variants, a comprehensive experimental design should include:

  • Genetic Materials Selection:

    • Use cybrids that differ specifically in ndhG alleles but maintain consistent genetic backgrounds

    • Include appropriate NDH knockout mutants (e.g., ndho, ndhm) as controls

    • Consider a full diallel of reciprocal hybrids differing only in plasmotype for genetic exclusion approaches

  • Phenotyping Approaches:

    • Implement high-throughput chlorophyll fluorescence imaging to measure:

      • Recovery of ΦPSII (quantum yield of PSII)

      • NDH activity via post-illumination fluorescence rise

    • Measure plant performance metrics like shoot dry weight

  • Environmental Variables:

    • Test multiple light regimes:

      • Constant light intensities

      • Fluctuating light with different frequencies (e.g., changes every 2 min, 10 min)

      • Highly fluctuating light mimicking natural canopy conditions

      • Sinusoidal light patterns during photoperiod

This design allows for the systematic evaluation of how ndhG variants affect photosynthetic efficiency and plant growth across different environmental contexts .

What control variables must be considered when studying NDH complex function?

When studying NDH complex function, several control variables must be carefully managed:

Control VariableImportanceImplementation
Genetic backgroundNucleotype affects NDH activity independent of plasmotypeUse cybrids or isogenic lines differing only in plasmotype
Light conditionsDifferent light regimes affect the relative importance of NDH-mediated CETStandardize light intensity, duration, and fluctuation patterns
Growth stagePlant developmental stage affects photosynthetic parametersUse plants of the same age and developmental stage
TemperatureAffects enzyme kinetics and stress responsesMaintain consistent temperature during growth and measurements
CO₂ concentrationInfluences photorespiration and photosynthetic efficiencyControl atmospheric or chamber CO₂ levels
Measurement timingDiurnal variations in photosynthetic activityPerform measurements at consistent times of day

Failure to control these variables may lead to confounding effects that obscure the specific impact of NDH complex variations on photosynthetic performance and plant growth .

How can researchers isolate the effects of ndhG variants from other genetic factors?

Isolating the effects of ndhG variants requires sophisticated genetic approaches:

  • Cybrid Creation: Generate cybrids containing the same nuclear genome (nucleotype) but different chloroplast genomes (plasmotypes) that vary in ndhG alleles. This allows for the direct comparison of ndhG allelic effects while controlling for nuclear genetic background.

  • Genetic Exclusion Approach: When multiple candidate genes might explain a phenotypic difference, use accessions that differ for remaining candidate SNPs in a full diallel of reciprocal hybrids. This approach can narrow down candidate genes through elimination.

  • Validation with Nuclear NDH Mutants: Use nuclear gene knockouts (e.g., ndho, ndhm) that affect NDH complex function to confirm that observed phenotypic differences are specifically related to NDH activity.

  • Phenotyping in Multiple Genetic Backgrounds: Test ndhG variants in combination with different nucleotypes to determine if the effect is consistent across genetic backgrounds. For example, research has shown that the relative reduction in NDH activity produced by the Bur-0 plasmotype compared to Col-0 plasmotype remains constant across different nucleotypes, confirming the specific effect of the ndhG allele .

What techniques can resolve contradictory findings regarding NDH complex importance?

Resolving contradictory findings about NDH complex importance requires multifaceted experimental approaches:

  • Environmental Complexity Analysis:

    • Test plant performance under diverse environmental conditions, particularly focusing on:

      • Constant versus fluctuating light

      • Different frequencies of light fluctuation

      • Natural versus artificial light patterns

      • Various stress conditions (temperature, drought)

  • Integrative Measurements:

    • Combine multiple measurement techniques:

      • Chlorophyll fluorescence imaging for ΦPSII and NDH activity

      • Gas exchange for photosynthetic rate

      • Growth and biomass accumulation

      • Metabolite profiling

  • Temporal Resolution:

    • Examine responses at different timescales:

      • Immediate photosynthetic responses (seconds to minutes)

      • Medium-term acclimation (hours to days)

      • Long-term performance (weeks to lifecycle completion)

This approach can reconcile apparently contradictory findings, such as why NDH mutants in Arabidopsis thaliana previously showed no significant role in plant performance under standard conditions, while showing substantial (62.7%) biomass reduction under highly fluctuating light conditions .

How should researchers interpret the trade-off between ΦPSII recovery and NDH-mediated CET?

The interpretation of the trade-off between ΦPSII recovery and NDH-mediated cyclic electron transport (CET) requires careful consideration of:

What statistical approaches are most appropriate for analyzing NDH complex phenotypic data?

Statistical ApproachApplicationAdvantagesConsiderations
Factorial ANOVAAnalyzing effects of multiple factors (e.g., nucleotype, plasmotype, environment) and their interactionsCaptures interactive effects between variablesRequires balanced experimental design
Mixed-effects modelsWhen including random effects (e.g., plant-to-plant variation) alongside fixed effectsAccounts for hierarchical data structureMore complex interpretation
Repeated measures ANOVAFor time-series data of NDH activity or ΦPSII recoveryAccounts for non-independence of sequential measurementsRequires appropriate handling of missing data
Multiple regressionRelating NDH activity to continuous environmental variablesQuantifies relationships between continuous variablesAssumes linearity unless specifically modeled
Principal Component AnalysisReducing dimensionality of multiple photosynthetic parametersIdentifies major sources of variationInterpretability may be challenging
Bayesian approachesWhen incorporating prior knowledge about NDH functionCan handle complex models with limited dataRequires specification of prior distributions

When analyzing NDH complex data, researchers should select statistical approaches that account for the hierarchical nature of the experimental design (e.g., plants nested within genotypes within environments) and that can appropriately handle interaction effects, which are often critical in photosynthesis research .

How can CRISPR-Cas9 technology be applied to study ndhG function?

While traditional transformation or gene editing methods cannot be easily used to test allelic variants of chloroplastic genes like ndhG, CRISPR-Cas9 technology offers promising advanced approaches:

  • Transplastomic CRISPR Systems:

    • Engineer plastid-targeted Cas9 and guide RNAs

    • Deliver the system through nuclear transformation

    • Target specific regions of the ndhG gene within the chloroplast genome

  • Methodological Workflow:

    • Clone ndhG variants into transformation vectors

    • Transform Arabidopsis using Agrobacterium-mediated transformation

    • Select transformants using appropriate markers

    • Confirm editing through sequencing

    • Characterize NDH activity using established fluorescence methods

    • Compare performance across various light conditions

  • Targeted Mutagenesis Approach:

    • Create specific amino acid substitutions (e.g., Lys7 to Ile7 and vice versa)

    • Generate series of mutations along conserved regions

    • Develop structure-function maps of ndhG

This approach would allow researchers to directly test the functional significance of specific amino acid positions, particularly the highly conserved N-terminus and the functionally important Ile7 position .

What emerging technologies can improve the study of NDH complex dynamics?

TechnologyApplication to NDH ResearchAdvantagesCurrent Limitations
Advanced Chlorophyll Fluorescence ImagingSpatio-temporal analysis of NDH activityHigh-throughput, non-destructiveLimited depth penetration in thick tissues
Cryo-EM Structural AnalysisDetailed structure of NDH complex with different ndhG variantsAtomic-level resolution of protein complexesChallenging sample preparation
Multi-omics IntegrationConnecting NDH activity to transcriptome, proteome, and metabolomeComprehensive view of system-level effectsComplex data integration challenges
Real-time Electron Flow VisualizationDirect measurement of electron transportImproved mechanistic understandingCurrently limited by technological constraints
Mathematical ModelingPredict effects of NDH variants under diverse conditionsEnables in silico testing of hypothesesRequires extensive parameterization
Synthetic Biology ApproachesEngineer optimized NDH complexesPotential to enhance photosynthetic efficiencyChallenging implementation in chloroplasts

These emerging technologies promise to provide deeper insights into the fundamental mechanisms of NDH function and how allelic variations in components like ndhG affect photosynthetic efficiency and plant performance under dynamic environmental conditions .

What are the most effective growth conditions for studying ndhG function in Arabidopsis thaliana?

Effective growth conditions for studying ndhG function should be tailored to reveal NDH complex activity and its impact on plant performance:

  • Basic Growth Parameters:

    • Growth medium: Standard soil mix or MS media for controlled nutrient conditions

    • Temperature: 22°C day/18°C night is optimal for Arabidopsis

    • Humidity: 60-70% relative humidity

    • Life cycle: Plan for approximately 6 weeks from germination to mature seed in standard conditions

  • Light Regimes for NDH Phenotyping:

    • Constant Light Conditions:

      • Moderate intensity (e.g., 340-415 μmol photons m⁻² s⁻¹)

      • 16/8 hour photoperiod

    • Fluctuating Light Regimes:

      • Short-interval fluctuations (every 2-10 minutes)

      • Sinusoidal patterns during photoperiod

      • Natural canopy-mimicking fluctuations (recorded from field conditions)

  • Experimental Duration:

    • Short-term measurements: 1-2 days for immediate photosynthetic responses

    • Medium-term: 2-3 weeks for acclimation responses

    • Full lifecycle: 5-6 weeks for comprehensive growth and reproductive assessment

How can researchers troubleshoot inconsistent NDH activity measurements?

When facing inconsistencies in NDH activity measurements, researchers should systematically address potential sources of variation:

  • Technical Considerations:

    • Instrumentation: Calibrate fluorescence imaging equipment regularly

    • Measurement Protocol: Standardize dark adaptation period (typically 15-30 minutes)

    • Image Analysis: Ensure consistent region-of-interest selection across samples

    • Timing: Conduct measurements at the same time of day to minimize diurnal effects

  • Biological Variables:

    • Leaf Age: Use leaves of consistent developmental stage (e.g., fully expanded but not senescent)

    • Growth Stage: Standardize plant age and developmental phase

    • Growth History: Control pre-measurement light conditions to avoid light memory effects

    • Water Status: Ensure consistent hydration as water stress affects NDH activity

  • Validation Approaches:

    • Positive Controls: Include known NDH mutants (ndho, ndhm) to confirm assay sensitivity

    • Technical Replicates: Perform multiple measurements per plant

    • Biological Replicates: Use sufficient sample sizes (minimum n=8 per genotype)

    • Alternative Methods: Validate results using complementary approaches (e.g., spectroscopic measurements)

How does ndhG variation affect plant performance across different environments?

The impact of ndhG variation on plant performance demonstrates complex environment-dependent patterns:

Light ConditionEffect of Bur-0 ndhG allele on ΦPSIIEffect on Shoot Dry WeightInterpretation
Constant light (415 μmol m⁻² s⁻¹)Increased ΦPSII recoveryNo significant effectFaster recovery doesn't translate to growth advantage under stable conditions
Constant light (340 μmol m⁻² s⁻¹)Increased ΦPSII recoveryNo significant effectConsistent with above finding at different light intensity
Fluctuating light (10 min intervals)Increased ΦPSII recoveryNo significant effectModerate fluctuations insufficient to reveal growth penalty or benefit
Highly fluctuating light (canopy-like)Reduced ΦPSII recovery10.1% reductionUnder extreme fluctuations, reduced NDH-mediated CET severely impacts growth
Sinusoidal fluctuating lightIncreased ΦPSII recovery3.6% increaseSpecific pattern of change provides advantage despite reduced NDH activity

These findings reveal that:

What insights do ndhG studies provide for understanding evolutionary constraints in photosynthesis?

Studies of ndhG variation provide several key insights into evolutionary constraints in photosynthesis:

  • Conservation Despite Variability:

    • The N-terminus of ndhG, particularly the Ile7 position, shows strong evolutionary conservation dating back to the common ancestor with cycads and ferns

    • This conservation persists despite some plant lineages having lost NDH complex genes entirely

    • The 29 genes related to the NDH complex persist in most plant families, indicating strong selective pressure

  • Environment-Dependent Selection:

    • The differential performance of ndhG variants across environments suggests that selection pressure varies with ecological context

    • The Bur-0 allele (Ile7 to Lys7) demonstrates potential advantages in specific light conditions while showing disadvantages in others

    • This environmental dependency may explain the maintenance of genetic variation in natural populations

  • Fundamental Trade-offs:

    • The ndhG research reveals an inherent trade-off between optimizing ΦPSII recovery and maintaining NDH-mediated CET

    • This represents a broader principle in photosynthetic evolution: optimization of one aspect often comes at the cost of another

    • Such trade-offs likely constrain the evolutionary trajectory of photosynthetic machinery across plant lineages

  • Implications for Other Photosynthetic Components:

    • The findings suggest similar trade-offs may exist for other components of the photosynthetic apparatus

    • Future research should investigate whether other conserved genes show similar patterns of environment-dependent fitness effects

    • Understanding these constraints may inform both evolutionary models and bioengineering approaches to photosynthesis enhancement

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.