Recombinant Arabidopsis thaliana NEP1-interacting protein 1 (NIP1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana NEP1-Interacting Protein 1 (NIP1)

Recombinant Arabidopsis thaliana NEP1-Interacting Protein 1 (NIP1) is a protein derived from the model plant Arabidopsis thaliana. It belongs to the nodulin 26-like intrinsic protein (NIP) subfamily of aquaporins, which are integral membrane proteins facilitating the transport of water and small solutes across cell membranes. NIP1;1 is specifically known for its role in the uptake of arsenite (As(III)) and other metalloids, impacting plant tolerance to these toxic substances.

Function and Significance of NIP1;1

NIP1;1 plays a crucial role in the transport of As(III) into plant roots, which can lead to arsenic toxicity. Mutants lacking functional NIP1;1 exhibit increased tolerance to arsenic due to reduced uptake of this toxic metalloid . This protein is also involved in the transport of other metalloids like antimony (Sb(III)) . The interaction of NIP1;1 with calcium-dependent protein kinase CPK31 suggests a potential regulatory mechanism for its activity in response to environmental stresses .

Research Findings on NIP1;1

Research on NIP1;1 has highlighted its importance in plant responses to environmental toxins. Key findings include:

  • Arsenic Uptake: NIP1;1 is a primary transporter for As(III) in Arabidopsis, with its loss-of-function mutants showing increased resistance to arsenic toxicity .

  • Regulation by CPK31: CPK31 interacts with NIP1;1, potentially modulating its activity through calcium signaling pathways .

  • Expression and Localization: NIP1;1 is highly expressed in roots and localized at the plasma membrane, where it facilitates the uptake of metalloids .

Data and Tables

While specific data tables for recombinant NIP1;1 are not readily available, research findings on its function and regulation can be summarized as follows:

CharacteristicsDescription
FunctionTransport of As(III) and other metalloids into plant roots.
LocalizationPlasma membrane of root cells.
RegulationInteracts with CPK31, potentially regulated by calcium signaling.
Mutant PhenotypeIncreased tolerance to arsenic due to reduced uptake.

References PubMed: Nep1-like proteins from three kingdoms of life act as a microbe-associated molecular pattern (MAMP) in Arabidopsis. Frontiers in Plant Science: Variation in membrane trafficking linked to SNARE proteins in Arabidopsis. PMC: Nep1-like proteins from three kingdoms of life act as MAMPs in Arabidopsis. Frontiers in Plant Science: Identification and characterization of Nep1-like proteins. PMC: Calcium-dependent protein kinase CPK31 interacts with arsenic transporter NIP1;1 in Arabidopsis. Creative BioMart: Recombinant Full Length Arabidopsis thaliana Nep1-Interacting Protein 1 (NIP1) protein. Frontiers in Microbiology: Functional characterization of Nep1-like protein effectors.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NIP1; ATL26; At4g35840; F4B14.110; NEP1-interacting protein 1; RING-H2 finger protein ATL26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NIP1
Target Protein Sequence
MASSRFQSGFCPISSCPSLENFIERIKDACRFTLSAVLGTILSAVLTFFFALVGTLLGAL TGALIGQETESGFIRGAAVGAISGAVFSIEVFESSLVLWKSNESRFGCLLYLIDVIVSLI SGRLVRERIGPAMLSAVQSQMGAVDSTFEELSSIFDTGGSKGLTGDLVDKIPKIKITGKN NLDASGNKDSCSVCLQDFQLGETVRSLPHCHHMFHLPCIDNWLFRHGSCPMCRRDL
Uniprot No.

Target Background

Function
Intrinsic thylakoid membrane protein that anchors RPOT2 to the stromal side of the thylakoid membrane.
Database Links

KEGG: ath:AT4G35840

STRING: 3702.AT4G35840.1

UniGene: At.31379

Protein Families
RING-type zinc finger family, NIP subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NEP1-interacting protein 1 (NIP1) in Arabidopsis thaliana?

NEP1-interacting protein 1 (NIP1) is a 236-amino acid protein in Arabidopsis thaliana that interacts with Necrosis and Ethylene-inducing Peptide 1 (NEP1). NIP1 belongs to the RING-H2 finger protein family and is also known as ATL26. The protein is encoded by the gene At4g35840 located on chromosome 4 (F4B14.110) and has the UniProt ID Q8GT75 . NIP1 is functionally implicated in plant immune responses triggered by Nep1-like proteins (NLPs), which are secreted by various plant-associated microorganisms including bacteria, fungi, and oomycetes .

NIP1 plays a significant role in the plant's molecular response system against potential pathogens, particularly in the context of microbe-associated molecular pattern (MAMP) recognition. Understanding this protein's structure and function contributes to our broader knowledge of plant innate immunity mechanisms.

How is recombinant Arabidopsis thaliana NIP1 produced for research purposes?

Recombinant Arabidopsis thaliana NIP1 protein is typically produced using heterologous expression systems, with E. coli being the most common host organism. The full-length protein (amino acids 1-236) is expressed with an N-terminal His-tag to facilitate purification . The production process generally follows these steps:

  • The NIP1 gene sequence is cloned into an appropriate expression vector that includes a His-tag coding sequence.

  • The recombinant vector is transformed into competent E. coli cells.

  • Protein expression is induced under optimized conditions.

  • The expressed protein is purified using affinity chromatography (typically Ni-NTA resin that binds the His-tag).

  • The purified protein is dialyzed and lyophilized into a powder form.

The final product is typically stored as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0. For research use, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL and stored with 5-50% glycerol (recommended 50%) to prevent freeze-thaw damage .

What is the relationship between NIP1 and Nep1-like proteins (NLPs)?

NIP1, as its name suggests (NEP1-interacting protein 1), interacts with NEP1 (Necrosis and Ethylene-inducing Peptide 1) and potentially other Nep1-like proteins (NLPs). NLPs constitute a family of proteins secreted by diverse plant-associated microorganisms from three kingdoms of life: bacteria, fungi, and oomycetes .

The relationship between NIP1 and NLPs is significant because:

  • NLPs are known to trigger plant defense responses and, in many cases, cell death in dicotyledonous plants .

  • NLPs can function as microbe-associated molecular patterns (MAMPs) that activate plant immunity .

  • Even non-cytotoxic NLPs, such as those from the biotrophic pathogen Hyaloperonospora arabidopsidis (HaNLPs), can act as potent activators of the plant immune system in Arabidopsis .

This interaction represents an important component of plant-microbe interactions, especially in the context of plant immune responses. The recognition of NLPs by plant proteins like NIP1 helps plants detect potential pathogens and mount appropriate defense responses.

What experimental methods are commonly used to study NIP1 function in plants?

Several experimental approaches are employed to investigate NIP1 function in plants:

  • Gene Expression Analysis: Quantitative RT-PCR (qRT-PCR) is used to measure NIP1 expression levels under various conditions, such as pathogen infection or abiotic stress .

  • Protein-Protein Interaction Assays:

    • Yeast two-hybrid (Y2H) systems to identify protein interaction partners

    • Co-immunoprecipitation (Co-IP) to confirm interactions in plant cells

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in vivo

  • Genetic Approaches:

    • T-DNA insertion mutants (such as those available from the Arabidopsis Biological Resource Center) to study loss-of-function phenotypes

    • Overexpression lines to examine gain-of-function phenotypes

    • CRISPR/Cas9-mediated gene editing for precise genetic manipulation

  • Subcellular Localization Studies:

    • Fluorescent protein fusions combined with confocal microscopy to determine the subcellular localization of NIP1

  • Physiological and Phenotypic Assays:

    • Plant growth measurements

    • Stress tolerance assays

    • Pathogen response assays

These methods collectively provide insights into NIP1's biological role, regulation, and contribution to plant immunity and stress responses.

What is the relationship between NIP1 and aluminum stress response in Arabidopsis?

While NIP1 and NIP1;2 are different proteins with distinct functions, understanding the relationship between NIP1;2 and aluminum stress can provide insights into the broader NIP family function. NIP1;2 functions as an aluminum-malate (Al-Mal) transporter involved in aluminum detoxification in Arabidopsis .

Key findings regarding NIP1;2 and aluminum stress include:

  • NIP1;2 is specifically involved in aluminum tolerance, as nip1;2 mutants show hypersensitivity to aluminum stress but not to other toxic metal ions (Cd²⁺, La³⁺, Zn²⁺, Cu²⁺) .

  • The NIP1;2-mediated aluminum tolerance mechanism involves:

    • Transport of aluminum-malate complexes

    • Removal of aluminum from root cell walls

    • Facilitation of root-to-shoot aluminum translocation

  • This mechanism operates in coordination with the ALMT1-mediated aluminum exclusion system:

    • ALMT1 mediates malate exudation from roots in response to aluminum stress

    • NIP1;2 then transports the formed aluminum-malate complexes

    • The loss of either component (ALMT1 or NIP1;2) compromises aluminum tolerance

  • NIP1;2 expression is not controlled by the STOP1 transcription factor, unlike other key aluminum tolerance genes (ALMT1, MATE, ALS3) .

This functional relationship demonstrates the importance of coordinated mechanisms between aluminum exclusion and internal detoxification in Arabidopsis.

How can researchers optimize expression and purification of recombinant Arabidopsis NIP1 to maintain functional integrity?

Optimizing the expression and purification of recombinant Arabidopsis NIP1 requires careful consideration of several factors to maintain its functional integrity:

Expression System Optimization:

  • Strain Selection: BL21(DE3) or Rosetta E. coli strains are recommended for expression of plant proteins like NIP1 to address codon bias issues.

  • Induction Conditions:

    • Temperature: Lower temperatures (16-20°C) often yield more soluble protein

    • IPTG concentration: 0.1-0.5 mM typically provides optimal induction

    • Induction duration: 16-20 hours at lower temperatures maximizes yield while minimizing inclusion body formation

  • Vector Design:

    • Including solubility-enhancing tags (e.g., MBP, SUMO) along with the His-tag can improve solubility

    • Codon optimization for E. coli expression

Purification Protocol:

  • Cell Lysis Buffer Optimization:

    • Buffer: Tris/PBS-based buffer at pH 8.0

    • Additives: 10-15% glycerol, 1-5 mM DTT or β-mercaptoethanol, and mild detergents (0.1% Triton X-100)

    • Protease inhibitors: Complete protease inhibitor cocktail

  • Affinity Purification:

    • Ni-NTA resin for His-tagged protein

    • Gradient washing with increasing imidazole (10-40 mM) before elution

    • Final elution with 250-300 mM imidazole

  • Post-Purification Processing:

    • Dialysis to remove imidazole

    • Addition of 6% trehalose as a stabilizing agent

    • Lyophilization under controlled conditions

Storage Conditions:

  • Store lyophilized protein at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50%

  • Aliquot to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Following these optimized protocols significantly improves the yield and functional integrity of recombinant Arabidopsis NIP1 for downstream applications.

How do NIP1-NLP interactions contribute to the molecular mechanisms of plant immunity?

The interaction between NIP1 and Nep1-like proteins (NLPs) represents a critical component of plant immunity. This interaction contributes to several key aspects of the plant immune response:

  • MAMP Recognition and Signaling:

    • NLPs from diverse microorganisms (bacteria, fungi, and oomycetes) can act as microbe-associated molecular patterns (MAMPs) .

    • A conserved 24-amino acid peptide region in the central part of NLPs has been identified as sufficient to trigger immunity in Arabidopsis .

    • NIP1 likely plays a role in recognizing these conserved NLP patterns and initiating downstream immune signaling.

  • Defense Gene Activation:

    • NLP recognition leads to the activation of defense-related genes, including pathogenesis-related protein 1 (PR-1) .

    • In Arabidopsis, exposure to NLPs from the biotrophic pathogen Hyaloperonospora arabidopsidis (HaNLPs) activated a large set of defense-related genes .

    • This transcriptional reprogramming is a key component of the plant immune response.

  • Immune-Associated Growth Inhibition:

    • Plants expressing NLPs or exposed to NLP peptides exhibit reduced growth, a phenomenon typically associated with enhanced immunity .

    • This growth-defense tradeoff reflects the resource allocation shift toward defense at the expense of growth.

  • Cross-Kingdom Recognition:

    • The ability of NIP1 to interact with NLPs from three different kingdoms of life (bacteria, fungi, and oomycetes) provides plants with a broad-spectrum recognition system for diverse potential pathogens .

    • This makes the NIP1-NLP interaction system unique as one of the first proteinaceous MAMP recognition systems identified across three kingdoms of life.

  • Cytotoxicity and Cell Death Responses:

    • Some NLPs induce cell death in dicot plants, while others are non-cytotoxic but still trigger immune responses .

    • The differential responses to cytotoxic and non-cytotoxic NLPs likely involve distinct downstream signaling pathways, potentially mediated by different interactions with NIP1 or related proteins.

Understanding these molecular mechanisms provides valuable insights for developing strategies to enhance plant immunity against a wide range of pathogens.

What are the challenges and solutions in studying NIP1-NLP specificity across different plant species?

Studying NIP1-NLP specificity across different plant species presents several significant challenges and potential solutions:

Challenges:

  • Dicot vs. Monocot Sensitivity Differences:

    • NLPs traditionally show cytotoxic activity predominantly in dicot plants but not monocots .

    • Recent evidence suggests some monocots, like onion (Allium cepa), show variable sensitivity to NLPs .

    • This differential sensitivity complicates cross-species comparisons.

  • Genetic and Functional Diversity:

    • NIP1 homologs vary across plant species with potentially different specificities.

    • NLPs show significant diversity within and between pathogen species.

    • Different plant species may have evolved distinct recognition mechanisms.

  • Technical Limitations:

    • Transformation and genetic manipulation are more challenging in non-model plant species.

    • Protein expression and purification from different plant species may require species-specific optimization.

    • Phenotypic responses to NLPs can be subtle and difficult to quantify consistently across species.

Solutions and Methodological Approaches:

  • Comparative Genomics and Proteomics:

    • Identify and compare NIP1 homologs across plant species using bioinformatics tools

    • Perform phylogenetic analyses to understand evolutionary relationships

    • Use protein modeling to predict structural conservation and divergence

  • Heterologous Expression Systems:

    • Express NIP1 homologs from different plant species in a common host (e.g., Nicotiana benthamiana) using agroinfiltration

    • Create chimeric proteins with domains from different species to pinpoint specificity-determining regions

    • Use yeast-based interaction assays to compare binding specificities

  • Synthetic Biology Approaches:

    • Design synthetic NLP peptides representing conserved and variable regions

    • Test these peptides across plant species using standardized assays

    • Create minimal functional domains to isolate core interaction determinants

  • Quantitative Assays:

    Assay TypeMeasurementAdvantageChallenge
    Ethylene ProductionGas chromatographyEarly response, quantitativeRequires specialized equipment
    ROS ProductionLuminol chemiluminescenceRapid, sensitiveTransient response
    Defense Gene ExpressionqRT-PCRSpecific, quantitativeVariable timing across species
    Electrolyte LeakageConductivityQuantitative, simpleDestructive, less specific
    Growth InhibitionFresh weight/root lengthIntegrative responseLong-term, affected by other factors
  • CRISPR/Cas9-based Approaches:

    • Generate knockout lines of NIP1 homologs in diverse plant species

    • Create precise amino acid substitutions to test functional conservation

    • Develop NIP1-reporter fusions to visualize responses in vivo

By combining these approaches, researchers can overcome the challenges in studying NIP1-NLP specificity across plant species and develop a more comprehensive understanding of this important plant-pathogen recognition system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.