Recombinant Arabidopsis thaliana NEP1-interacting protein-like 1 (ATL27)

What is the structure and function of ATL27 in Arabidopsis thaliana?

ATL27 (At5g66070, K2A18.15) is a 221-amino acid protein that belongs to the RING-H2 finger protein family. It functions as a NEP1-interacting protein-like 1 and is part of the Arabidopsis Tóxicos en Levadura (ATL) family of E3 ubiquitin ligases. The full-length protein contains key domains essential for its function, including:

• N-terminal transmembrane domain

• C-terminal RING-H2 finger domain critical for E3 ligase activity

• Protein-protein interaction motifs

The amino acid sequence of ATL27 is: MDGYYSLSPISVLHRIKDSFHFAVSALLANLFSALFTFFFALVGTLLGALTGALIGQETESGFIRGAAVGAISGAVFSIEVFESSLLLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVESQFQDHTDIFDTAISKGLTGDSLNRIPKVRITDTSPEIVSCSVCL QDFQVGETVRSLPHCHHMFHLPCIDKWLRRHASCPLCRRHL .

Like other ATL family members such as ATL2, ATL27 likely plays a role in plant defense mechanisms, potentially mediating protein degradation through the ubiquitin-proteasome system in response to pathogen infection .

How is ATL27 related to the broader ATL family of proteins?

ATL27 is one member of the broader ATL family, which comprises RING-H2 finger proteins that function as E3 ubiquitin ligases. Research on related family members provides insights into ATL27's potential functions:

• The ATL family is characterized by a highly conserved RING-H2 domain that is essential for E3 ubiquitin ligase activity

• Based on studies of ATL2, a related family member, ATL proteins are typically membrane-localized and involved in plant defense responses

• ATL2 is localized to the plasma membrane and is critical for defense against fungal pathogens like Alternaria brassicicola

• The ATL family members generally function in the ubiquitin/26S proteasome pathway, targeting specific proteins for degradation

Though each ATL protein has distinct functions, the family as a whole appears to play important roles in plant immunity and stress responses.

What expression patterns does ATL27 exhibit in plant tissues?

While specific expression data for ATL27 is limited in the provided search results, insights can be gained from related ATL proteins:

Similar to ATL2, ATL27 likely has:

• Low basal expression under normal growth conditions

• Significant upregulation in response to pathogen-associated molecular patterns (PAMPs) such as chitin

• Tissue-specific expression patterns that correlate with defense response requirements

For example, ATL2 expression is rapidly and significantly induced by exogenous chitin treatment, suggesting a role in PAMP-triggered immunity . By extension, ATL27 may show similar induction patterns in response to specific pathogen-derived elicitors or during infection.

How do NEP1-like proteins interact with plant defense systems?

NEP1-like proteins (NLPs) are microbial proteins secreted by plant pathogenic oomycetes, fungi, and bacteria that trigger comprehensive immune responses in Arabidopsis thaliana and other plants. Understanding these interactions provides context for ATL27's role:

NLPs trigger multiple defense responses in plants, including:

• Activation of mitogen-activated protein kinase pathways

• Deposition of callose in cell walls

• Production of nitric oxide and reactive oxygen intermediates

• Ethylene biosynthesis

• Phytoalexin production (e.g., camalexin)

• Programmed cell death

NLPs cause extensive transcriptional reprogramming in Arabidopsis, similar to that observed with established pathogen-associated molecular patterns (PAMPs). They function as both elicitors of plant immunity and as toxins that cause host cell death, particularly in dicotyledonous plants .

Since ATL27 is characterized as a NEP1-interacting protein, it likely plays a role in the plant's response to these pathogen-derived molecules, potentially through protein ubiquitination and subsequent degradation.

What methods are most effective for expressing and purifying recombinant ATL27?

Effective expression and purification of recombinant ATL27 requires careful consideration of expression systems, tags, and purification strategies:

Expression System Optimization:

• E. coli expression is commonly used for ATL27 protein production

• For full-length ATL27 (1-221 amino acids), an N-terminal His-tag approach has proven successful

• Expression conditions: Induction parameters, temperature, and media composition should be optimized for maximum soluble protein yield

Purification Protocol:

• Harvest cells and lyse using appropriate buffer systems

• Perform affinity chromatography using Ni-NTA resin to capture His-tagged ATL27

• Consider including a gel filtration step to improve purity

• Store purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Reconstitution Guidelines:

• For lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C

• Avoid repeated freeze-thaw cycles as they compromise protein stability

For functional studies, it's critical to verify protein activity after purification by assessing its E3 ligase activity using in vitro ubiquitination assays.

How can researchers effectively study ATL27's potential E3 ubiquitin ligase activity?

Based on its RING-H2 domain and similarity to other ATL family members like ATL2, ATL27 likely functions as an E3 ubiquitin ligase. To study this activity:

In Vitro Ubiquitination Assays:

• Set up reactions containing:

  • Purified recombinant ATL27

  • E1 ubiquitin-activating enzyme

  • E2 ubiquitin-conjugating enzyme (test multiple E2s to identify optimal pairing)

  • Ubiquitin (preferably labeled or tagged for detection)

  • ATP and buffer components

• Analyze reaction products by Western blotting to detect:

  • Auto-ubiquitination of ATL27 (self-regulation)

  • Ubiquitination of potential substrates

Mutational Analysis:

• Create targeted mutations in the RING domain, particularly at conserved cysteine residues

• Based on research with ATL2, where cysteine 138 was identified as critical for function, similar conserved residues in ATL27 would be prime targets for mutagenesis

• Compare activity of wild-type and mutant versions to confirm functional residues

Substrate Identification Approaches:

• Yeast two-hybrid screening

• Co-immunoprecipitation coupled with mass spectrometry

• Proximity-dependent biotin identification (BioID) or proximity ligation assays (PLA)

What techniques are recommended for studying ATL27 localization and membrane integration?

Understanding ATL27's subcellular localization is critical for determining its function. Based on knowledge from related proteins:

Fluorescent Protein Fusion Approaches:

• Generate constructs expressing ATL27 fused to fluorescent proteins (e.g., GFP, mCherry)

• Transform Arabidopsis protoplasts or whole plants for transient or stable expression

• Visualize localization using confocal microscopy

• Perform co-localization studies with known subcellular markers

Biochemical Fractionation:

• Isolate cellular fractions (membrane, cytosol, nuclei)

• Detect ATL27 in different fractions by Western blotting

• Use differential detergent treatments to determine membrane integration strength

Topology Studies:

• Protease protection assays to determine orientation in membranes

• Glycosylation site mapping for transmembrane domain characterization

This approach was effective for ATL2, which was conclusively shown to be plasma membrane-localized through "bioinformatics, live-cell confocal imaging, and cell fractionation analysis" .

How does ATL27 potentially contribute to plant immune responses?

While direct evidence for ATL27's role in immunity is limited in the search results, insights can be drawn from related ATL proteins and the NEP1-interaction:

Potential Immune Functions Based on ATL Family Studies:

• Regulation of defense-related protein turnover through targeted ubiquitination

• Modulation of PAMP-triggered immunity signaling cascades

• Contribution to defense against specific pathogen classes

Experimental Approaches to Study ATL27 in Immunity:

• Generate and characterize atl27 knockout or knockdown lines

• Perform pathogen infection assays with multiple pathogen types

• Analyze defense marker gene expression in mutant vs. wild-type plants

• Conduct transcriptome analysis before and after pathogen challenge

For example, the atl2 null mutant showed higher susceptibility to Alternaria brassicicola, while ATL2-overexpressing plants displayed increased resistance . Similar experimental approaches could reveal ATL27's specific contributions to immunity.

NEP1 Connection:
Since ATL27 is characterized as NEP1-interacting, it may play a role in the plant's response to NLPs, which are known to trigger comprehensive immune responses including:

• Activation of defense-related genes

• Production of reactive oxygen species and nitric oxide

• Deposition of callose

• Synthesis of phytoalexins and ethylene

• Programmed cell death

What are the current challenges in identifying ATL27 substrates and how can they be overcome?

Identifying E3 ligase substrates is notoriously challenging but critical for understanding ATL27 function:

Current Challenges:

• Transient and low-abundance nature of ubiquitinated intermediates

• Difficulty in capturing direct enzyme-substrate interactions

• Potential redundancy with other ATL family members

• Technical limitations in detecting specific ubiquitination events in vivo

Advanced Methodological Solutions:

Validation Strategies:

• In vitro ubiquitination assays with candidate substrates

• Co-immunoprecipitation to confirm physical interaction

• Cell-free degradation assays to verify ATL27-dependent proteolysis

• In vivo half-life studies of candidate substrates

By combining multiple approaches, researchers can overcome the inherent challenges in substrate identification and build a comprehensive understanding of ATL27's biological targets and functions.

How can CRISPR-Cas9 technology be utilized to study ATL27 function?

CRISPR-Cas9 genome editing offers powerful approaches for functional characterization of ATL27:

Knockout Strategy:

• Design sgRNAs targeting early exons of ATL27 gene

• Generate complete knockout lines

• Phenotype mutants under normal and stress conditions (particularly pathogen challenge)

• Perform complementation tests to confirm phenotype specificity

Domain-Specific Editing:

• Create precise mutations in functional domains (e.g., RING-H2 finger domain)

• Generate plants with point mutations in critical residues (similar to the cysteine 138 identified in ATL2)

• Assess protein function without complete loss of the protein

Promoter Editing:

• Modify ATL27 promoter to alter expression patterns

• Create reporter fusions to study native regulation

Multiplex Editing:

• Target multiple ATL family members simultaneously to overcome functional redundancy

• Create higher-order mutants to reveal masked phenotypes

When designing CRISPR experiments, researchers should consider potential off-target effects and implement appropriate controls, including the use of multiple independent guide RNAs and complementation with the wild-type gene.

What approaches are recommended for studying ATL27 regulation during pathogen infection?

Understanding how ATL27 is regulated during infection provides insights into its role in plant immunity:

Transcriptional Regulation:

• Quantitative RT-PCR analysis of ATL27 expression during infection time course

• Promoter-reporter fusions (e.g., ATL27pro:GUS) to visualize spatial expression patterns

• Chromatin immunoprecipitation (ChIP) to identify transcription factors binding the ATL27 promoter

Post-Translational Regulation:

• Western blot analysis to monitor protein levels and modifications

• Use of proteasome inhibitors to assess protein stability

• Phosphorylation site mapping through mass spectrometry

• Analysis of protein-protein interactions during infection

Experimental Design Considerations:

• Include multiple pathogen types (bacterial, fungal, oomycete)

• Analyze responses to purified PAMPs (like chitin, flagellin, or NLPs)

• Compare local and systemic responses

• Include appropriate time points (early, middle, and late infection stages)

For example, in studies of ATL2, protein stability was markedly increased via chitin treatment, suggesting post-translational regulation in addition to transcriptional induction . Similar regulatory mechanisms may apply to ATL27.

How does ATL27 compare with other members of the ATL family in terms of structure and function?

A comparative analysis of ATL family members provides context for understanding ATL27's unique and shared properties:

Structural Comparisons:

• All ATL proteins contain a characteristic RING-H2 finger domain essential for E3 ligase activity

• Many ATL proteins possess transmembrane domains that determine subcellular localization

• Specific motifs outside the conserved domains likely confer substrate specificity

Functional Comparisons:

• ATL2 is plasma membrane-localized and critical for defense against fungal pathogens

• Different ATL family members may target distinct substrates for ubiquitination

• Some ATLs respond to different stimuli (pathogens, hormones, abiotic stress)

Phylogenetic Relationships:
The ATL family likely evolved through gene duplication events, with different members specializing in various aspects of plant defense and development. This evolutionary divergence explains both the functional overlap and specificity observed among family members.

Research Approach for Comparative Studies:

• Perform multiple sequence alignments to identify conserved and variable regions

• Generate phylogenetic trees to establish evolutionary relationships

• Compare expression patterns across different conditions and tissues

• Conduct cross-complementation experiments between different ATL mutants

What techniques are recommended for studying protein-protein interactions involving ATL27?

Investigating ATL27's interactome is crucial for understanding its biological function:

In Vitro Interaction Methods:

• Pull-down assays using recombinant His-tagged ATL27

• Surface plasmon resonance (SPR) to measure binding kinetics

• Isothermal titration calorimetry (ITC) for thermodynamic analysis of interactions

In Vivo Interaction Methods:

• Yeast two-hybrid screening (Y2H)

• Split-ubiquitin system (particularly useful for membrane proteins)

• Co-immunoprecipitation (Co-IP) followed by Western blotting or mass spectrometry

• Bimolecular fluorescence complementation (BiFC) for visualizing interactions in plant cells

• Förster resonance energy transfer (FRET) for analyzing protein proximity

Validation and Characterization Strategies:

• Confirm interactions using multiple independent methods

• Map interaction domains through deletion and point mutation analysis

• Determine the biological significance of interactions using genetic approaches

• Assess how interactions change under different conditions (e.g., pathogen infection)

Special Considerations for Membrane Proteins:
Since ATL27 likely contains transmembrane domains (like other ATL family members), specialized approaches for membrane protein interactions should be considered, such as membrane yeast two-hybrid or proximity-based labeling methods.

What are the emerging research areas for ATL27 and related proteins?

Several promising research directions could advance our understanding of ATL27:

Systems Biology Approaches:

• Integration of transcriptomics, proteomics, and metabolomics data to place ATL27 in broader signaling networks

• Network modeling to predict ATL27 functions and interactions

• Comparative genomics across plant species to understand evolutionary conservation and divergence

Structural Biology:

• Determination of ATL27's three-dimensional structure, particularly the RING-H2 domain

• Structure-guided design of mutations to probe function

• Co-crystallization with interacting partners to understand molecular recognition

Synthetic Biology Applications:

• Engineering ATL27 to target specific proteins for degradation

• Creation of tunable plant immune responses through modified ATL27 activity

• Developing ATL27-based biosensors for pathogen detection

Translational Research:

• Exploring how ATL27 manipulation might enhance crop resistance to pathogens

• Developing targeted approaches to modulate ATL27 activity in agricultural applications

These emerging areas represent the frontier of ATL27 research and offer exciting possibilities for both fundamental discoveries and practical applications.