Recombinant Arabidopsis thaliana NEP1-interacting protein-like 2 (ATL24)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Plant Immunity

ATL24 interacts with Nep1-like proteins (NLPs), which are secreted by pathogens and trigger immune responses in Arabidopsis thaliana:

  • Immune Activation: Noncytotoxic NLPs, such as HaNLP3 from Hyaloperonospora arabidopsidis, bind ATL24 to induce defense gene expression and ethylene production .

  • MAMP Activity: A synthetic 24-amino-acid peptide derived from the central region of HaNLP3 (homologous to ATL24-interacting regions) activates immunity in Arabidopsis .

Production and Purification

Recombinant ATL24 is optimized for high yield and purity:

ParameterDetails
Expression SystemE. coli
Purification MethodAffinity chromatography (Ni-NTA for His tag)
Purity≥85% (SDS-PAGE)
Storage Conditions-20°C or -80°C in Tris buffer with 50% glycerol
ApplicationsELISA, Western blot, structural studies, immune response assays

The Arabidopsis-based super-expression system has achieved yields of up to 0.4 mg purified protein per gram of plant tissue in related studies .

Key Studies

  • Immune Signaling: ATL24 mediates immune responses triggered by NLPs across bacterial, fungal, and oomycete pathogens .

  • Structural Insights: The RING-H2 domain of ATL24 facilitates ubiquitination, a process critical for degrading pathogen effectors .

  • Interaction Networks: ATL24 is part of a larger interactome mapped in Arabidopsis, though specific partners remain under investigation .

Comparative Activity of NLP-Derived Peptides

Peptide SourceImmune Activation in Arabidopsis
HaNLP3 (H. arabidopsidis)Strong ethylene induction
Bacterial NLPsModerate immune activation
Fungal NLPsVariable responses

Applications in Research

  • Pathogen-Host Interaction Studies: Used to dissect mechanisms of MAMP-triggered immunity .

  • Protein Interaction Mapping: Integrated into the Arabidopsis Protein Interactome Database (AtPID) for systems biology approaches .

  • Biochemical Assays: Employed in enzymatic activity studies due to its solubility and stability in recombinant form .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATL24; At1g74410; F1M20.9; NEP1-interacting protein-like 2; RING-H2 finger protein ATL24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
ATL24
Target Protein Sequence
MDTTLSPAVEAEQIADSTIDTVSRLIAGVFSGALTGIFAMAGAFTGAVTGAVAGRAAQYG VLRGAALGAVAGAILSVEVLEASRAYWYLELSGSRGPSSMADFVEQLFRGRLVDEQLMST MINSHHWQLRISDVSYEEREDVYGELEARGLSGDSLRKLPCYIMSSEMVRRQVTHCTICL QDIKTGEITRSLPKCDHTFHLVCVDKWLIRHGSCPICRQAVKD
Uniprot No.

Target Background

Function
Potentially involved in the early stages of plant defense signaling pathways. Lacks E3 ubiquitin ligase catalytic activity.
Database Links

KEGG: ath:AT1G74410

STRING: 3702.AT1G74410.1

UniGene: At.20400

Protein Families
RING-type zinc finger family, NIP subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of recombinant ATL24 protein in Arabidopsis thaliana?

ATL24 belongs to the ATL family that encodes RING-H2 finger domain proteins in Arabidopsis thaliana. Like most members of the ATL family, ATL24 is characterized by its RING-H2 finger domain, which is critical for its ubiquitin ligase activity. The basic protein structure is likely conserved as a functional module, as suggested by the fact that approximately 90% of ATL genes are intronless . For recombinant expression, the full coding sequence can be cloned without intron considerations, making it relatively straightforward for heterologous expression systems.

How does ATL24 compare structurally to other members of the ATL family?

When comparing ATL24 to other members of the ATL family, researchers should examine sequence similarities beyond the conserved RING-H2 finger domain. The ATL family in Arabidopsis thaliana consists of approximately 80 members, with varying degrees of sequence similarity . Many ATLs show clustering patterns that suggest functional relationships, with about 60% of rice ATLs clustering with Arabidopsis ATLs, indicating potential orthologous relationships across species . Comparison studies should include phylogenetic analysis to determine the evolutionary relationship of ATL24 to other family members.

What is the molecular mechanism through which ATL24 interacts with NEP1-like proteins?

NEP1-like proteins (NLPs) function as molecular patterns recognized by plants to trigger immunity responses. The interaction between ATL24 and NLPs likely involves the recognition of the conserved 24-amino acid peptide (nlp24) found in the central domain of NLPs . This interaction potentially connects ubiquitin-mediated protein degradation (a function of ATL family proteins) with pattern-triggered immunity activated by NLPs. The exact binding interface and structural requirements for this interaction remain areas for detailed investigation through techniques such as co-immunoprecipitation and yeast two-hybrid assays.

What are the optimal conditions for recombinant expression of ATL24 in heterologous systems?

For successful recombinant expression of ATL24, researchers should consider:

Expression SystemOptimal ConditionsSpecial Considerations
E. coliBL21(DE3) strain, 18-25°C induction, 0.1-0.5 mM IPTGAddition of zinc in media may improve RING domain folding
Insect cellsSf9 or High Five™ cells, 27°C, 48-72h post-infectionBetter for preserving post-translational modifications
Plant expressionN. benthamiana transient expressionProvides plant-specific modifications and folding environment

Consider using fusion tags (His6, GST, MBP) to improve solubility and facilitate purification. Since ATL proteins function as ubiquitin ligases, maintain reducing conditions throughout purification to preserve cysteine residues in the RING domain. Validate protein activity through in vitro ubiquitination assays using recombinant E1 and E2 enzymes.

How can researchers effectively study the interaction between ATL24 and NEP1-like proteins?

To study the ATL24-NLP interaction, employ multiple complementary approaches:

  • In vitro binding assays: Use purified recombinant ATL24 and synthetic nlp24 peptides derived from various NLPs to determine binding affinity and specificity through techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC).

  • Co-immunoprecipitation: Express tagged versions of ATL24 and NLPs in plant cells, then perform co-IP experiments to verify their interaction in a cellular context.

  • Bimolecular Fluorescence Complementation (BiFC): Fuse ATL24 and NLPs to complementary fragments of a fluorescent protein to visualize their interaction and subcellular localization in planta.

  • Yeast two-hybrid assays: Map the specific domains involved in the interaction by testing truncated versions of both proteins.

Remember that plant immunity receptors like RLP23 have been identified as receptors for NLPs , so consider including these receptors in your experimental design to investigate potential three-way interactions.

What phenotypic assays are most informative for studying ATL24 function in Arabidopsis?

To characterize ATL24 function in vivo, implement these phenotypic assays:

  • T-DNA insertion or CRISPR knockout lines: Generate ATL24-deficient plants and screen for developmental abnormalities, similar to the approach used for other ATL genes that revealed essential roles for viability .

  • Pathogen challenge assays: Expose ATL24 mutants to various pathogens, particularly those producing NLPs, and measure disease progression, bacterial/fungal growth, and defense marker expression.

  • Hormone response assays: Test sensitivity to plant hormones involved in defense responses (salicylic acid, jasmonic acid, ethylene) similar to the ABA insensitivity observed in ATL43 mutants .

  • NLP response assays: Treat plants with purified NLPs or nlp24 peptides and measure ethylene production, ROS burst, and defense gene expression to determine if ATL24 affects NLP-triggered immunity .

  • Ubiquitination target identification: Use immunoprecipitation coupled with mass spectrometry to identify proteins whose ubiquitination status changes in ATL24 mutants following NLP treatment.

How does post-translational modification of ATL24 affect its function in plant immunity?

ATL24's function as a ubiquitin ligase may itself be regulated by post-translational modifications (PTMs). When investigating ATL24 PTMs:

  • Identify phosphorylation sites using phosphoproteomic approaches before and after NLP treatment to determine if ATL24 activity is modulated by defense-related kinases.

  • Examine whether ATL24 undergoes auto-ubiquitination, which could regulate its stability and function during immune responses.

  • Investigate whether S-nitrosylation or redox-dependent modifications of the cysteine-rich RING domain affect ATL24's E3 ligase activity, particularly during oxidative bursts associated with immune responses.

  • Explore crosstalk between different PTMs using site-directed mutagenesis of modified residues combined with functional assays.

The regulatory networks controlling ATL proteins should be mapped in the context of plant-pathogen interactions, as different PTM patterns may emerge depending on the challenging pathogen or PAMP.

How does ATL24 contribute to the specificity of plant responses to different NEP1-like proteins?

NLPs are found in various microorganisms including bacteria, fungi, and oomycetes . Research questions to address include:

  • Does ATL24 show differential binding affinities to nlp24 peptides derived from different microbial sources? Quantitative binding assays with peptides from diverse origins can reveal potential specificity.

  • Are there co-receptors or adaptor proteins that modulate ATL24-NLP interactions in a pathogen-specific manner?

  • What is the relationship between ATL24 and the identified NLP receptor RLP23 ? Does ATL24 function downstream of RLP23 signaling, or do they represent parallel recognition systems?

  • How does ATL24 contribute to the differential amplitude or timing of defense responses against different NLP-producing pathogens?

Answering these questions requires a combination of biochemical assays, genetic analysis, and in vivo pathogen challenge experiments with diverse NLP-producing microbes.

What is the relationship between ATL24 and other components of the plant ubiquitin-proteasome system during immune responses?

ATL24, as a RING-H2 E3 ubiquitin ligase, functions within the broader ubiquitin-proteasome system. Advanced research should examine:

  • Which E2 ubiquitin-conjugating enzymes partner with ATL24 during immune responses? Different E2-E3 pairs can generate different ubiquitin chain topologies with distinct signaling outcomes.

  • Does ATL24 participate in multi-protein E3 ligase complexes during NLP-triggered immunity?

  • How does ATL24 activity coordinate with other immunity-related E3 ligases such as PUB13 or CPR1?

  • What are the kinetics of protein degradation mediated by ATL24 following NLP perception, and how does this timing relate to the progression of defense responses?

These questions can be addressed through proteomic approaches, including proximity labeling techniques (BioID, TurboID) to capture transient interactions in the ubiquitination cascade during immunity activation.

How should researchers interpret transcriptomic data for ATL24 in the context of plant immunity?

When analyzing transcriptomic data:

  • Compare ATL24 expression patterns with those of known defense regulators to identify potential co-regulated gene clusters.

  • Examine whether ATL24 expression changes in response to different pathogens, PAMPs, or hormone treatments using publicly available datasets.

  • Perform time-course analyses to determine the kinetics of ATL24 expression relative to early and late immune markers.

  • Conduct cell type-specific expression analysis to determine if ATL24 functions in specific tissues or cell types during immunity.

Integrate transcriptomic data with proteomic and genetic interaction data to build comprehensive models of ATL24 function in immunity networks. Researchers should be cautious about interpreting expression data alone, as post-translational regulation may be more significant for E3 ligase function than transcriptional changes.

What statistical approaches are most appropriate for analyzing ATL24-dependent ubiquitinome changes?

Ubiquitinome analysis generates complex datasets requiring careful statistical handling:

  • Use limma-based statistical frameworks for differential ubiquitination analysis, with appropriate corrections for multiple testing (Benjamini-Hochberg FDR).

  • Implement WGCNA (Weighted Gene Correlation Network Analysis) to identify modules of co-regulated ubiquitination targets.

  • Apply enrichment analyses for GO terms, protein domains, and cellular compartments to identify biological processes regulated by ATL24-mediated ubiquitination.

  • Consider K-means clustering or self-organizing maps to group proteins with similar ubiquitination patterns across time points or treatments.

  • Validate key targets using targeted approaches like selected reaction monitoring (SRM) mass spectrometry or western blotting with ubiquitin-specific antibodies.

Fold Change=log2(Ubiquitination in wild-typeUbiquitination in atl24 mutant)\text{Fold Change} = \log_2\left(\frac{\text{Ubiquitination in wild-type}}{\text{Ubiquitination in atl24 mutant}}\right)

Proteins with significant positive fold-change values are potential ATL24 ubiquitination targets.

How can researchers distinguish direct ATL24 targets from indirect effects in large-scale proteomic datasets?

Distinguishing direct from indirect effects is challenging but critical:

  • Perform in vitro ubiquitination assays with recombinant ATL24 and candidate substrates to confirm direct ubiquitination.

  • Use rapid induction systems (e.g., DEX-inducible ATL24 expression) combined with protein synthesis inhibitors to identify early ubiquitination events before secondary effects occur.

  • Identify ATL24 interacting proteins through IP-MS approaches and cross-reference with ubiquitinome data to prioritize likely direct targets.

  • Compare ubiquitination site sequences among potential targets to identify possible recognition motifs for ATL24.

  • Implement network analysis approaches that can distinguish between primary and secondary nodes in ubiquitination networks.

Direct targets will show ubiquitination changes rapidly after ATL24 activation and should physically interact with ATL24 in co-IP or yeast two-hybrid experiments.

How has ATL24 evolved compared to other ATL family members in different plant species?

Evolutionary analysis of ATL24 should address:

  • Construct phylogenetic trees including ATL24 orthologs from diverse plant species, ranging from mosses to flowering plants, to trace its evolutionary history.

  • Compare selection pressures (dN/dS ratios) on different domains of ATL24 to identify regions under purifying or diversifying selection.

  • Analyze syntenic relationships between genomic regions containing ATL24 in different species to understand the role of genome duplications in ATL family expansion.

  • Compare conservation patterns of the RING-H2 domain versus other protein regions to identify functionally critical residues.

About 60% of rice ATLs cluster with Arabidopsis ATLs, suggesting conservation of function across species . Determine whether ATL24 falls within these conserved clusters or represents a more divergent member of the family.

What structural and functional differences exist between ATL24 and other NEP1-interacting proteins in plants?

Compare ATL24 with other NEP1-interacting proteins by:

  • Conducting domain organization analysis to identify shared and unique structural features.

  • Performing binding affinity measurements to determine if different NEP1-interacting proteins have distinct preferences for specific NLPs.

  • Investigating tissue-specific and developmental expression patterns to identify potential functional specialization.

  • Comparing the phenotypes of plants with mutations in different NEP1-interacting proteins to reveal functional redundancy or specialization.

  • Analyzing co-expression networks to identify protein groups that function in concert with different NEP1-interacting proteins.

This comparative approach will help define the unique contribution of ATL24 within the broader context of plant-NLP interactions.

What are the most promising approaches for developing ATL24-based strategies to enhance plant immunity?

Future research directions include:

  • Engineering ATL24 with enhanced or altered specificity toward particular pathogen effectors or PAMPs could provide novel resistance mechanisms.

  • Identifying small molecules that modulate ATL24 activity could lead to chemical priming agents for crop protection.

  • Investigating natural variation in ATL24 across Arabidopsis accessions to identify alleles with enhanced immunity functions for potential transfer to crops.

  • Exploring the application of knowledge about ATL24-NLP interactions to develop novel pathogen detection systems for agricultural diagnostics.

  • Studying the potential of ATL24 orthologs in crop species as targets for CRISPR-based gene editing to enhance broad-spectrum disease resistance.

Each of these approaches requires thorough understanding of ATL24's molecular mechanisms and careful consideration of potential pleiotropic effects on plant growth and development.

How might systems biology approaches advance our understanding of ATL24 in plant immunity networks?

Systems biology offers powerful frameworks for studying ATL24:

  • Multi-omics integration: Combine transcriptomics, proteomics, metabolomics, and phenomics data from ATL24 mutants under various conditions to build comprehensive network models.

  • Dynamical systems modeling: Develop mathematical models that capture the temporal dynamics of ATL24-mediated responses to pathogen detection.

  • Network perturbation analysis: Use CRISPR interference or overexpression of ATL24 and its partners to systematically probe network robustness and identify critical nodes.

  • Comparative systems biology: Apply network analysis across multiple plant species to identify conserved and divergent aspects of ATL24 function.

These approaches will help position ATL24 within the broader context of plant immunity networks and could reveal unexpected connections to other biological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.