Recombinant Arabidopsis thaliana Nudix hydrolase 11 (NUDT11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its inclusion in production.
Synonyms
NUDT11; NUDX11; At5g45940; K15I22.14; Nudix hydrolase 11; AtNUDT11; Coenzyme A diphosphatase NUDT11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
NUDT11
Target Protein Sequence
MSSTTTDSTELQNLIKLFQNCQTHPRQHFPAKSSAVLVCLYQEQREDKNELRVILTKRST TLSSHPGEVALPGGKRDQEDKDDIATALREAREEIGLDPSLVTIISVLEPFVNKKGMSVA PVIGFLHDKKAFKQLPNPAEVEEIFDVPLEMFLKDRNRRAEEREHEGERYLLQYFDYYSE DKERSFIIWALTAGILIRVASIVYQRLPEFQERKPSFWNQPN
Uniprot No.

Target Background

Function
Recombinant Arabidopsis thaliana Nudix hydrolase 11 (NUDT11) is a coenzyme A diphosphatase that catalyzes the cleavage of CoA into 3',5'-ADP and 4'-phosphopantetheine. It can utilize malonyl-CoA, hexanoyl-CoA, lauroyl-CoA, myristoyl-CoA, and palmitoyl-CoA as substrates, but not isobutyryl-CoA or propionyl-CoA.
Gene References Into Functions
  1. Comparative studies on gene regulation, kinetic parameters, and intracellular localization of AtNUDX11, 15, and 15a. PMID: 22232253
  2. AtCoAse, a Nudix hydrolase, is investigated. Transgenic Arabidopsis plants overexpressing AtCoAse exhibit altered growth rates and developmental patterns. PMID: 19340986
Database Links

KEGG: ath:AT5G45940

STRING: 3702.AT5G45940.1

UniGene: At.29985

Protein Families
Nudix hydrolase family, PCD1 subfamily
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots, stems and leaves.

Q&A

How does NUDT11 function compare to other cytosolic Nudix hydrolases in Arabidopsis?

AtNUDT11 is classified among the cytosolic Nudix hydrolases in Arabidopsis (AtNUDT1-11 and AtNUDT25) . Research indicates that expression patterns of cytosolic AtNUDTs are individually regulated in different tissues, suggesting specialized roles . Other cytosolic AtNUDTs like AtNUDT2, AtNUDT6, AtNUDT7, and AtNUDT10 demonstrate ADP-ribose and NADH pyrophosphatase activities with high affinities compared to animal and yeast enzymes . While detailed comparison data for AtNUDT11 specifically is limited in these search results, its classification within this group suggests potential involvement in similar nucleotide metabolism pathways.

What is the subcellular localization of NUDT11 in Arabidopsis cells?

Based on the available research, AtNUDT11, together with AtNUDT1-10, is predicted to be localized in the cytosol . This contrasts with other Arabidopsis Nudix hydrolases that are targeted to organelles such as mitochondria (AtNUDT12-18) or chloroplasts (AtNUDT19-24) . Subcellular localization is important as it provides insights into the potential functional roles and substrate accessibility of these enzymes in plant cells.

How is NUDT11 expression regulated across different plant tissues and developmental stages?

Research indicates that the expression of each AtNUDT is individually regulated in different tissues . While specific details about AtNUDT11 expression patterns are not extensively covered in the provided research materials, this tissue-specific regulation suggests that AtNUDT11 may have specialized functions in certain plant tissues or developmental stages. Comprehensive expression profiling using techniques such as qRT-PCR or RNA-Seq across different tissues and developmental stages would be required to fully characterize the expression patterns of AtNUDT11.

What are the preferred substrates of recombinant NUDT11 and its catalytic properties?

For comparative purposes, other Arabidopsis Nudix hydrolases exhibit distinct substrate preferences:

  • AtNUDT13: Preferentially hydrolyzes diadenosine hexaphosphate (Ap6A), with Km and kcat/Km values of 0.61 mM and 16.0 × 10³ M⁻¹·s⁻¹, respectively

  • AtNUDT14: Preferred substrate is ADP-ribose (Km = 13.0 ± 0.7 μM) with much lower affinity for ADP-glucose (Km = 1,235 ± 65 μM)

What experimental conditions optimize NUDT11 enzymatic activity?

While specific conditions for AtNUDT11 are not detailed in the provided research, related Nudix hydrolases can offer insights. For example, AtNUDT13 shows optimal activity at alkaline pH (8.5) with Mg²⁺ (5 mM) as the cofactor . When designing enzymatic assays for recombinant AtNUDT11, researchers should consider testing:

  • pH range from 7.0-9.0

  • Different divalent metal ions as cofactors (typically Mg²⁺, Mn²⁺)

  • Temperature range (typically 25-37°C)

  • Buffer composition effects on activity

Optimization of these parameters should be performed systematically to determine the conditions that maximize AtNUDT11 activity.

What are the most effective expression systems for producing active recombinant NUDT11?

Based on the provided research on related Nudix hydrolases, Escherichia coli appears to be an effective heterologous expression system for Arabidopsis Nudix proteins. For example, AtNUDT13, a 202 amino acid polypeptide, was successfully overexpressed in E. coli and purified to homogeneity while maintaining enzymatic activity .

For recombinant AtNUDT11 expression, researchers should consider:

  • E. coli strain selection (BL21(DE3), Rosetta, etc.)

  • Induction conditions (IPTG concentration, temperature, duration)

  • Inclusion of fusion tags (His-tag, GST, etc.) for purification

  • Codon optimization if necessary

  • Solubility enhancement strategies (lower induction temperature, co-expression with chaperones)

The choice of expression vector and purification strategy should be optimized based on the specific requirements of downstream applications.

What is known about the structural features of NUDT11 and how do they relate to its function?

While the specific structural features of AtNUDT11 are not detailed in the provided research, insights can be gained from other characterized Nudix hydrolases. The Nudix hydrolase family is characterized by the conserved Nudix box motif (GX₅EX₇REUXEEXGU, where U represents a hydrophobic residue) . This motif forms part of the catalytic site responsible for substrate binding and hydrolysis.

For instance, AtNUDT13 was determined to exist as a monomer in solution through chemical crosslinking and size exclusion chromatography . Structure-function relationship studies of other Nudix hydrolases could provide a framework for understanding how the structure of AtNUDT11 might contribute to its substrate specificity and catalytic mechanism.

What phenotypes are observed in NUDT11 knockout or overexpression lines?

When designing knockout or overexpression studies for AtNUDT11, researchers should consider examining:

  • Growth and developmental phenotypes

  • Stress response characteristics

  • Metabolic profiling to identify changes in nucleotide-related metabolites

  • Transcriptomic analysis to identify affected pathways

  • Physiological parameters under normal and stress conditions

How does NUDT11 contribute to stress responses in Arabidopsis?

While specific data on AtNUDT11's role in stress responses is not detailed in the provided research, Nudix hydrolases generally play important roles in stress responses by regulating the levels of various nucleotide derivatives that may accumulate under stress conditions. A systematic approach to studying AtNUDT11's role in stress responses would involve:

  • Expression analysis of AtNUDT11 under various abiotic stresses (drought, salt, temperature, etc.)

  • Phenotyping of knockout/overexpression lines under stress conditions

  • Metabolomic analysis to identify stress-related metabolites affected by AtNUDT11 activity

  • Comparison with other stress-responsive Nudix hydrolases

How does Arabidopsis NUDT11 compare to its homologs in other plants and in animals?

While detailed comparative analysis of AtNUDT11 across species is not extensively covered in the provided research, human NUDT11 has been implicated in prostate cancer pathogenesis . Suppressing human NUDT11 expression inhibited proliferation/viability by 63% and decreased anchorage-independent colony formation by 86.3% in cancer cells .

For a comprehensive comparative analysis of AtNUDT11, researchers should:

  • Perform phylogenetic analysis to identify closest homologs across species

  • Compare substrate specificities and catalytic properties

  • Analyze expression patterns and tissue distribution

  • Evaluate structural conservation of key domains

  • Compare knockout phenotypes where available

This comparative approach would provide insights into the evolutionary conservation and potential functional divergence of NUDT11 across species.

What are the most effective methods for studying NUDT11 enzyme kinetics and substrate specificity?

Based on approaches used for other Nudix hydrolases, effective methods for studying AtNUDT11 enzyme kinetics include:

  • Spectrophotometric assays for real-time monitoring of hydrolysis reactions

  • High-performance liquid chromatography (HPLC) for product analysis

  • Mass spectrometry for definitive identification of reaction products

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters of substrate binding

For example, mass spectrometry analysis was used to determine that the products of diadenosine hexaphosphate hydrolysis by AtNUDT13 were ADP and adenosine tetraphosphate . Similar approaches could be applied to characterize AtNUDT11 substrate specificity and reaction products.

What advanced techniques are available for studying protein-protein interactions involving NUDT11?

To study potential protein-protein interactions involving AtNUDT11, researchers could employ:

  • Yeast two-hybrid screening to identify interacting partners

  • Co-immunoprecipitation followed by mass spectrometry

  • Bimolecular fluorescence complementation (BiFC) for in vivo validation

  • Surface plasmon resonance (SPR) for quantitative binding parameters

  • Protein microarrays for high-throughput interaction screening

These approaches would help elucidate the potential role of AtNUDT11 in larger protein complexes or signaling networks.

How can recombinant NUDT11 be utilized as a tool in metabolic research?

Recombinant AtNUDT11 could potentially serve as a valuable tool in metabolic research through:

  • Use as a reagent for specific hydrolysis of target nucleotide derivatives in complex mixtures

  • Development of biosensors for detection of specific metabolites

  • Metabolic engineering applications to modulate nucleotide metabolism

  • Structure-based design of inhibitors for studying metabolic pathways

The specific applications would depend on the substrate specificity of AtNUDT11, which would need to be thoroughly characterized through the enzymatic analysis methods described above.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.