Recombinant Arabidopsis thaliana O-acyltransferase WSD1 (WSD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for prioritized development.
Synonyms
WSD1; At5g37300; MNJ8.9; Wax ester synthase/diacylglycerol acyltransferase 1; WS/DGAT 1; Diacylglycerol O-acyltransferase; DGAT; Long-chain-alcohol O-fatty-acyltransferase; O-acyltransferase WSD1; Wax synthase; WS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
WSD1
Target Protein Sequence
MKAEKVMEREIETTPIEPLSPMSHMLSSPNFFIVITFGFKTRCNRSAFVDGINNTLINAP RFSSKMEINYKKKGEPVWIPVKLRVDDHIIVPDLEYSNIQNPDQFVEDYTSNIANIPMDM SKPLWEFHLLNMKTSKAESLAIVKIHHSIGDGMSLMSLLLACSRKISDPDALVSNTTATK KPADSMAWWLFVGFWFMIRVTFTTIVEFSKLMLTVCFLEDTKNPLMGNPSDGFQSWKVVH RIISFEDVKLIKDTMNMKVNDVLLGMTQAGLSRYLSSKYDGSTAEKKKILEKLRVRGAVA INLRPATKIEDLADMMAKGSKCRWGNFIGTVIFPLWVKSEKDPLEYIRRAKATMDRKKIS LEAFFFYGIIKFTLKFFGGKAVEAFGKRIFGHTSLAFSNVKGPDEEISFFHHPISYIAGS ALVGAQALNIHFISYVDKIVINLAVDTTTIQDPNRLCDDMVEALEIIKSATQGEIFHKTE V
Uniprot No.

Target Background

Function
WSD1 (Wax ester synthase/diacylglycerol acyltransferase) is a bifunctional enzyme involved in cuticular wax biosynthesis. It plays a crucial role in reducing leaf water loss, particularly under drought conditions.
Gene References Into Functions
  1. Plays a key role in wax ester synthesis in stems. PMID: 18621978
Database Links

KEGG: ath:AT5G37300

STRING: 3702.AT5G37300.1

UniGene: At.6994

Protein Families
Long-chain O-acyltransferase family
Subcellular Location
Cell membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in flowers, siliques, top parts of stems, and leaves. Not found in roots, seeds and young seedlings.

Q&A

What is Arabidopsis thaliana O-acyltransferase WSD1 and what is its primary function?

WSD1 is a member of the bifunctional wax ester synthase/diacylglycerol acyltransferase gene family that plays a key role in wax ester synthesis in Arabidopsis thaliana stems. In vitro assays using protein extracts from Escherichia coli expressing WSD1 have demonstrated that this enzyme possesses high wax synthase activity and approximately 10-fold lower level of diacylglycerol acyltransferase activity . Expression of the WSD1 gene in Saccharomyces cerevisiae results in the accumulation of wax esters, but not triacylglycerol, confirming that WSD1 predominantly functions as a wax synthase . The protein is essential for cuticular wax biosynthesis, particularly in stem wax ester synthesis.

Where is WSD1 expressed in Arabidopsis thaliana?

Analysis of WSD1 expression reveals that this gene is transcribed in flowers, top parts of stems, and leaves . More detailed expression studies using promoter-GUS fusion have shown that WSD1 is expressed in seeds throughout their entire growth period, as well as in the abscission zones at the bottoms of siliques, buds, flowers, seedlings, stem tops, trichomes of stem bases, and hydathodes of rosette leaves and cauline leaves . The GUS signal was observed in the epidermis cells of stem tops, though it was not epidermis-specific . These expression patterns indicate that WSD1 functions in both vegetative and reproductive organs of the plant.

What is the subcellular localization of WSD1?

Fully functional yellow fluorescent protein-tagged WSD1 protein has been localized to the endoplasmic reticulum (ER) . This subcellular localization demonstrates that the biosynthesis of wax esters, which are the final products of the alcohol-forming pathway, occurs in this compartment . Protein structure analysis reveals that WSD1 from Arabidopsis thaliana contains one transmembrane domain (TrM), while some WSD1 homologs in other species may contain different numbers of TrM regions .

How does WSD1 contribute to cuticular wax composition?

WSD1 plays a crucial role in cuticular wax biosynthesis, particularly in the formation of wax esters. Wax esters are neutral lipids composed of aliphatic alcohols and acids, with both moieties usually long-chain (C16 and C18) or very-long-chain (C20 and longer) carbon structures . In plants, wax esters are mostly found in the cuticles coating primary shoot surfaces and contribute to the plant's water barrier properties and environmental protection . The importance of WSD1 in this process is evidenced by severely reduced wax ester levels in the stem wax of wsd1 mutant plants .

What phenotypes are observed in WSD1 mutant or overexpression plants?

WSD1 mutant plants (wsd1) exhibit severely reduced wax ester levels in their stem wax, demonstrating the enzyme's key role in wax ester synthesis . Conversely, plants overexpressing WSD1 (OE-At5g02890) display a glossy stem phenotype, indicating alterations in epicuticular wax crystal formation . Cryogenic-scanning electron microscopy studies have revealed differences in the wax crystal structure on stem surfaces of these overexpressing plants compared to wild-type plants . Transmission electron microscopy examination of the stem epidermal cuticle has also shown alterations in the cuticle proper and cuticular layer in WSD1 overexpressing plants .

What is the evolutionary relationship between WSD1 and other acyltransferases in plants?

Phylogenetic analysis of plant diacylglycerol acyltransferase (DGAT) families, including WSD1, reveals that they form distinct clades. WSD1 belongs to the WS/DGAT clade, which is separate from the DGAT1, DGAT2, and DGAT3 clades . Within each clade, monocots and eudicots form distinct clusters. Interestingly, homologous sequences with high levels of sequence identity to Arabidopsis WSD1 are all from the Brassicaceae family . While Arabidopsis thaliana contains a single WSD1 locus, some other Brassicaceae species contain two or more homologous genes . For example, Brassica napus has four homologous genes, though functional studies suggest that not all paralogs may have the same function .

What is the relationship between WSD1 function and plant hormone pathways?

Research indicates complex relationships between cuticular wax composition (influenced by WSD1) and plant hormone pathways. Studies have shown that:

  • The cuticle functions not merely as a physical barrier to minimize water loss but also mediates osmotic stress signaling and tolerance by regulating ABA biosynthesis and signaling .

  • Very long-chain fatty acids (VLCFAs), which are components of cuticular wax, are required for polar auxin transport .

  • Alterations in cuticular wax composition can affect the regulation of hormone response-associated genes .

  • Low VLCFA content increases the synthesis of the phytohormone cytokinin in the vasculature .

These findings suggest an intimate and complex relationship between WSD1-mediated wax production and hormone pathways that merits further investigation .

What are optimal methods for expressing and purifying recombinant WSD1 protein?

Recombinant WSD1 protein can be successfully expressed in both bacterial and yeast systems. For bacterial expression, Escherichia coli has been effectively used to produce WSD1 protein for in vitro enzyme assays . The recombinant protein can be produced with various tags determined during the production process and stored in Tris-based buffer with 50% glycerol at -20°C (for extended storage, -80°C is recommended) . Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

For functional studies, expression in Saccharomyces cerevisiae has proven effective, resulting in the accumulation of wax esters that can be analyzed to confirm WSD1's function as a wax synthase . This heterologous expression system is particularly useful for characterizing the enzymatic properties of WSD1.

How can WSD1 enzyme activity be assayed in vitro?

WSD1 enzyme activity can be assayed by measuring its wax synthase and diacylglycerol acyltransferase activities separately:

  • For wax synthase activity: Incubate the recombinant WSD1 protein with appropriate substrates (fatty acyl-CoAs and fatty alcohols) and measure the formation of wax esters using chromatographic methods.

  • For diacylglycerol acyltransferase activity: Use diacylglycerol and fatty acyl-CoAs as substrates and measure the formation of triacylglycerol, noting that this activity is approximately 10-fold lower than the wax synthase activity .

The enzyme displays bifunctional activity with EC numbers 2.3.1.75 (Long-chain-alcohol O-fatty-acyltransferase) and 2.3.1.20 (Diacylglycerol O-acyltransferase) , which should be considered when designing activity assays.

What imaging techniques are most suitable for analyzing cuticular wax changes in WSD1 mutants?

Several imaging techniques have proven valuable for analyzing cuticular wax changes in WSD1 mutants or overexpression lines:

  • Cryogenic scanning electron microscopy (cryo-SEM) is highly effective for examining epicuticular wax crystal formation on plant surfaces, allowing visualization of the three-dimensional structure of wax crystals on the stem surface .

  • Transmission electron microscopy (TEM) is useful for examining the ultrastructure of the plant cuticle, including the cuticle proper and cuticular layer, and can reveal changes in cuticle thickness or organization resulting from altered WSD1 expression .

  • Confocal microscopy can be used to visualize fluorescently tagged WSD1 protein (e.g., YFP-WSD1) to confirm its subcellular localization in the endoplasmic reticulum .

  • Light microscopy with histochemical staining (e.g., GUS staining for promoter activity studies) can help determine the tissue-specific expression pattern of WSD1 .

What bioinformatic tools are recommended for identifying WSD1 homologs in other species?

To identify WSD1 homologs in other species, researchers can employ several bioinformatic approaches:

  • BLAST searches (TBLASTX, BLASTX, and BLASTP) using the Arabidopsis thaliana WSD1 sequence as a query against protein and genome databases, such as NCBI and Phytozome, with an e-value threshold of 1.0e-20 .

  • Multiple sequence alignment tools to align identified sequences and assess sequence conservation.

  • Phylogenetic analysis software to construct evolutionary trees and determine the relationships between WSD1 homologs across species. This approach has revealed that homologous sequences with high levels of sequence identity to Arabidopsis WSD1 are primarily found in the Brassicaceae family .

  • Protein domain prediction tools to identify characteristic features of WSD1, such as transmembrane domains (TrM). WSD1 from Arabidopsis thaliana contains one TrM, while some homologs may have different numbers of TrM regions or none at all .

How should researchers interpret contradictory results in WSD1 functional studies?

When encountering contradictory results in WSD1 functional studies, researchers should consider:

  • Genetic background effects: Different Arabidopsis ecotypes or genetic backgrounds may influence WSD1 function and phenotypic outcomes.

  • Environmental conditions: WSD1 function and wax biosynthesis may be affected by growth conditions, including temperature, humidity, and light intensity.

  • Functional redundancy: Although Arabidopsis contains a single WSD1 gene, other enzymes might partially compensate for its function in certain conditions or tissues.

  • Technical variations: Different methods for analyzing wax composition (GC-MS, TLC, etc.) may yield varying results that appear contradictory.

  • Pleiotropic effects: Changes in WSD1 expression may have indirect effects on other metabolic pathways, complicating the interpretation of phenotypes.

A comprehensive approach involving multiple independent lines, different experimental conditions, and complementary analytical techniques is recommended to resolve contradictions .

What are promising areas for future WSD1 research?

Several promising research directions for WSD1 include:

  • Investigating the regulatory mechanisms controlling WSD1 expression in response to environmental stresses.

  • Exploring the detailed molecular interactions between WSD1 and other components of the wax biosynthesis pathway.

  • Examining the potential biotechnological applications of WSD1 in producing valuable wax esters for industrial purposes.

  • Investigating the role of WSD1 in crop species and its potential for improving drought tolerance and other agronomic traits.

  • Elucidating the mechanistic basis for the interactions between WSD1-mediated wax production and plant hormone signaling pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.