Recombinant Arabidopsis thaliana Oleosin 14.9 kDa (OL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us for preferential development.
Synonyms
OL3; At5g51210; MWD22.16; Oleosin 14.9 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-141
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OL3
Target Protein Sequence
ADQTRTHHEMISRDSTQEAHPKARQMVKAATAVTAGGSLLVLSGLTLAGTVIALTVATPL LVIFSPVLVPAVVTVALIITGFLASGGFGIAAITAFSWLYRHMTGSGSDKIENARMKVGS RVQDTKYGQHNIGVQHQQVS
Uniprot No.

Target Background

Function
Oleosin 14.9 kDa (OL3) likely plays a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It probably interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipases during lipolysis in seedling growth.
Database Links

KEGG: ath:AT5G51210

STRING: 3702.AT5G51210.1

UniGene: At.9693

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein.

Q&A

What are the recommended storage conditions for recombinant OL3 protein?

For optimal stability and activity of recombinant Arabidopsis thaliana Oleosin 14.9 kDa (OL3) protein, long-term storage should be at -20°C/-80°C in aliquoted formats to prevent repeated freeze-thaw cycles, which significantly reduce protein integrity. When working with the protein, short-term storage of working aliquots at 4°C is recommended for up to one week .

For reconstitution, it's advisable to:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage aliquots

  • Store these aliquots at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and storage .

How can I validate the expression of recombinant OL3 in transgenic Arabidopsis?

Validating recombinant OL3 expression in transgenic Arabidopsis requires a multi-step approach:

  • RNA level validation: Extract total RNA from approximately 20 mg of Arabidopsis seeds using Trizol reagent. Synthesize cDNA from 1 μg of total RNA and perform RT-PCR amplification. The recommended RT-PCR program includes:

    • Pre-denaturation at 94°C for 8 min

    • 30 cycles of: 94°C for 30 s, 56°C for 30 s, and 72°C for 1 min

    • Visualize amplified products on a 1.2% w/v agarose gel

  • Protein level validation: Western blot analysis can be used to confirm the presence and quantify the recombinant protein. This is particularly important for fusion proteins such as oleosin-hEGF-hEGF, where expression levels of up to 14.83 ng/μL have been reported in oil bodies .

  • Functional validation: For fusion proteins, functional assays specific to the fusion partner (e.g., proliferation assays for hEGF fusions) can confirm the biological activity of the recombinant protein .

How can I optimize the extraction of oil bodies containing recombinant OL3 fusion proteins from transgenic Arabidopsis seeds?

Optimizing oil body extraction containing recombinant OL3 fusion proteins requires careful consideration of several parameters:

  • Seed preparation: Use approximately 20 μg of T3 generation transgenic seeds for consistent results. Immerse seeds in 100 μL of PBS (pH 7.5) prior to grinding to facilitate extraction .

  • Extraction method: Thoroughly grind seeds to disrupt cellular structures and then extract oil bodies using gradient centrifugation. This technique separates oil bodies based on their density, allowing for the isolation of relatively pure oil body fractions .

  • Purification considerations:

    • Temperature control throughout the extraction process is critical to maintain protein integrity

    • Buffer composition affects extraction efficiency; PBS at pH 7.5 has proven effective

    • Multiple centrifugation steps may be necessary to remove contaminants

    • Gentle handling prevents oil body coalescence and protein denaturation

  • Quantification: Western blot analysis with appropriate standards can be used to determine the concentration of the recombinant protein in the extracted oil bodies. Expression levels of approximately 14.83 ng/μL have been reported for oleosin-hEGF-hEGF fusion proteins .

What are the key differences in using OL3 versus other oleosin isoforms as fusion partners for recombinant protein expression?

Arabidopsis thaliana contains multiple oleosin isoforms that differ in their size, expression patterns, and structural characteristics. When selecting OL3 (14.9 kDa) versus other oleosin isoforms as fusion partners, researchers should consider:

  • Size considerations: The relatively small size of OL3 (14.9 kDa) may offer advantages for:

    • Reduced steric hindrance in fusion proteins

    • Potentially higher expression levels due to lower metabolic burden

    • Enhanced transdermal absorption (as demonstrated with oleosin-hEGF-hEGF fusions, where smaller oil bodies showed greater skin permeability)

  • Expression regulation: Different oleosin promoters have varying strengths and temporal expression patterns. The phaseolin promoter has been successfully used for oleosin-hEGF-hEGF expression, providing good yield in seeds .

  • Fusion orientation: For OL3, N-terminal fusions have proven effective for recombinant protein expression, as demonstrated in the oleosin-hEGF-hEGF study . This orientation maintains the hydrophobic domain's integration into the oil body while allowing the fusion partner to extend into the aqueous environment.

  • Purification efficiency: The unique structural properties of OL3 may affect the ease of purification and yield of the fusion protein. Gradient centrifugation methods have been effective for isolating OL3-containing oil bodies .

How can I evaluate the functional activity of recombinant OL3 fusion proteins in cell-based assays?

Evaluating the functional activity of recombinant OL3 fusion proteins requires carefully designed cell-based assays appropriate to the fusion partner. For example, with oleosin-hEGF-hEGF fusion:

  • Cell proliferation assay protocol:

    • Culture NIH/3T3 cells in DMEM low-sugar medium

    • Seed cells in 96-well plates at a density of 5 × 10^4 cells/mL

    • Treat cells with different concentrations of extracted oil bodies containing the fusion protein

    • Incubate for 48 hours at 37°C

    • Add 25 μL of 5 mg/mL MTT solution to each well

    • Incubate at 37°C for 4 hours

    • Add 100 μL of dimethyl sulfoxide to each well

    • Measure absorbance at 570/630 nm using a microplate reader

  • Positive and negative controls:

    • Include commercial purified EGF as a positive control

    • Use wild-type oil bodies (without fusion protein) as a negative control

    • Include untreated cells as a baseline control

  • Dose-response relationship:

    • Test multiple concentrations of the fusion protein to establish a dose-response curve

    • Calculate EC50 values to quantitatively compare the potency of different constructs

Research has shown that oil bodies expressing oleosin-hEGF-hEGF can effectively stimulate NIH/3T3 cell proliferation, demonstrating the functional activity of the fusion protein .

What are the critical factors to consider when designing recombinant OL3 fusion proteins for targeted applications?

Designing effective recombinant OL3 fusion proteins requires careful consideration of several factors:

  • Fusion partner selection:

    • Size: Larger fusion partners may affect oil body formation and stability

    • Folding requirements: Proteins requiring extensive disulfide bonding or post-translational modifications may not express properly

    • Activity requirements: Consider whether the fusion partner needs to be cleaved from oleosin for activity

  • Linker design:

    • Include appropriate linker sequences between OL3 and the fusion partner to minimize steric hindrance

    • Consider protease cleavage sites if separation of the fusion partner is required

    • Optimize linker length and flexibility based on the structural requirements of the fusion partner

  • Expression vector design:

    • Select appropriate promoters (such as phaseolin) for seed-specific expression

    • Optimize codon usage for Arabidopsis expression

    • Include necessary selectable markers for transformation (such as Basta resistance)

  • Transformant selection strategy:

    • Implement dual screening approaches (herbicide resistance and PCR/RT-PCR) to identify true transformants

    • Advance to T3 homozygous generation to ensure stable expression

    • Verify Mendelian inheritance ratios (3:1) to confirm single-locus insertion

How can I troubleshoot low expression levels of recombinant OL3 fusion proteins in transgenic Arabidopsis?

Low expression of recombinant OL3 fusion proteins can result from multiple factors. A systematic troubleshooting approach should include:

  • Genetic construct evaluation:

    • Verify the integrity of the expression construct by sequencing

    • Confirm the presence of all necessary regulatory elements

    • Check for potential cryptic splice sites or premature stop codons

  • Transformation efficiency assessment:

    • Evaluate the transformation protocol and optimize if necessary

    • Increase the number of transformants screened to identify high-expressing lines

    • Consider alternative transformation methods if current approach yields poor results

  • Transcriptional analysis:

    • Perform quantitative RT-PCR to measure transcript levels

    • Compare transcript levels across different transgenic lines

    • Investigate potential silencing mechanisms if transcript levels are unexpectedly low

  • Protein stability considerations:

    • Assess protein degradation using pulse-chase experiments

    • Evaluate the effect of protease inhibitors on protein recovery

    • Consider co-expression of chaperones to improve protein folding and stability

  • Oil body formation analysis:

    • Examine oil body morphology using microscopy

    • Compare oil body size and abundance between transgenic and wild-type plants

    • Evaluate the impact of growth conditions on oil body formation and protein accumulation

Research has shown that optimization of these factors can lead to expression levels of approximately 14.83 ng/μL oil body for oleosin-fusion proteins .

What analytical techniques are most effective for characterizing the structure and purity of recombinant OL3 protein?

Comprehensive characterization of recombinant OL3 protein requires multiple analytical approaches:

  • Purity assessment:

    • SDS-PAGE analysis: The purity of recombinant OL3 protein should be greater than 90% as determined by SDS-PAGE

    • Size exclusion chromatography: To identify potential aggregates or degradation products

    • Reversed-phase HPLC: For higher resolution separation of closely related species

  • Structural characterization:

    • Mass spectrometry: For accurate molecular weight determination and identification of post-translational modifications

    • Circular dichroism: To assess secondary structure content

    • FTIR spectroscopy: For analysis of protein secondary structure in membrane environments

  • Functional characterization:

    • Oil body targeting assays: To confirm the ability of recombinant OL3 to associate with oil bodies

    • Stability studies: To evaluate the thermal and pH stability of the recombinant protein

    • For fusion proteins: Biological activity assays specific to the fusion partner

  • Immunological methods:

    • Western blotting: For specific detection and quantification

    • ELISA: For sensitive quantification of the protein

    • Immunohistochemistry: For localization studies in transgenic plants

How can I accurately quantify the expression levels of recombinant OL3 fusion proteins in oil bodies?

Accurate quantification of recombinant OL3 fusion proteins in oil bodies requires careful application of appropriate analytical methods:

  • Western blot quantification:

    • Extract oil bodies using gradient centrifugation

    • Prepare a standard curve using purified protein of known concentration

    • Separate proteins by SDS-PAGE and transfer to a membrane

    • Probe with specific antibodies against either the OL3 portion or the fusion partner

    • Analyze band intensities using densitometry

    • Calculate protein concentration by comparison to the standard curve

    This approach has been used to determine expression levels of oleosin-hEGF-hEGF at approximately 14.83 ng/μL oil body .

  • ELISA-based quantification:

    • Develop a sandwich or competitive ELISA using antibodies specific to the recombinant protein

    • Generate a standard curve with purified protein

    • Prepare appropriate dilutions of oil body extracts

    • Calculate protein concentration from the standard curve

  • Mass spectrometry-based quantification:

    • Use stable isotope-labeled internal standards

    • Extract proteins from oil bodies

    • Perform tryptic digestion

    • Analyze by LC-MS/MS

    • Calculate protein abundance based on peak areas

How can recombinant OL3 fusion technology be applied to enhance transdermal delivery of therapeutic proteins?

Recombinant OL3 fusion technology shows promise for transdermal delivery applications based on several key advantages:

  • Size-dependent penetration enhancement:

    • Transgenic oil bodies expressing recombinant oleosin-hEGF-hEGF have been shown to be smaller than control oil bodies

    • These smaller oil bodies demonstrate enhanced skin permeability

    • Immunohistochemical staining reveals greater staining intensity of transgenic oil bodies compared to EGF alone at all time points during transdermal absorption

  • Methodological approach for transdermal delivery optimization:

    • Design fusion constructs with therapeutic proteins of interest

    • Generate transgenic Arabidopsis plants expressing the fusion proteins

    • Extract oil bodies containing the fusion proteins

    • Assess transdermal absorption using:

      • Immunohistochemical staining to track penetration depth and distribution

      • Functional assays to confirm activity after penetration

      • Quantitative analysis to determine delivery efficiency

  • Parameters affecting transdermal delivery efficiency:

    • Oil body size: Smaller oil bodies (as observed with oleosin-hEGF-hEGF) demonstrate enhanced penetration

    • Fusion protein design: The orientation and linker regions between oleosin and the therapeutic protein

    • Formulation components: Additional excipients may enhance penetration

    • Application method: Occlusion, microneedles, or other physical methods may improve delivery

What are the potential research directions for using OL3 as a molecular tool in stress response studies?

While OL3 is primarily known for its role in oil body formation, it also has potential applications in stress response research:

  • Stress response gene expression systems:

    • OL3 promoter elements could be used to drive stress-responsive expression

    • Transgenic lines with OL3-reporter gene fusions could help monitor environmental stress responses

    • The regulation of OL3 itself during stress conditions could provide insights into plant adaptation mechanisms

  • Integration with ozone response pathways:

    • Arabidopsis accessions show natural variation in responses to environmental stressors such as ozone

    • Transcriptomic studies have identified thousands of genes with altered expression during ozone exposure

    • Combining OL3 fusion technology with ozone response pathways could lead to novel research tools

  • Methodology for integrating OL3 technology with stress studies:

    • Generate transgenic Arabidopsis lines expressing OL3 fusions with stress-responsive proteins

    • Subject plants to controlled stress conditions

    • Analyze transcriptional, protein expression, and physiological responses

    • Compare responses between different Arabidopsis accessions to leverage natural variation

Research has shown that Arabidopsis accessions (Col-0, Sha, Cvi-0) display accession-specific transcriptional responses to environmental stressors, with thousands of genes showing differential expression . This natural variation could be leveraged in conjunction with OL3 technology to develop new research tools.

What are the most common challenges in producing high-purity recombinant OL3 protein and how can they be overcome?

Researchers frequently encounter several challenges when producing high-purity recombinant OL3 protein. These challenges and their solutions include:

  • Expression level optimization:
    Challenge: Low expression yield
    Solutions:

    • Optimize codon usage for the expression host

    • Test different promoters to increase transcription

    • Evaluate various expression hosts (E. coli strains optimized for membrane proteins)

    • Adjust induction conditions (temperature, inducer concentration, induction time)

  • Protein solubility issues:
    Challenge: Formation of inclusion bodies due to the hydrophobic domain
    Solutions:

    • Express as a fusion with solubility-enhancing tags (MBP, SUMO, etc.)

    • Use specialized E. coli strains that enhance membrane protein expression

    • Optimize growth temperature (lower temperatures often reduce inclusion body formation)

    • Add mild detergents to extraction buffers to maintain solubility

  • Purification challenges:
    Challenge: Achieving >90% purity
    Solutions:

    • Implement multi-step purification strategies

    • For His-tagged constructs, optimize imidazole concentrations in washing and elution buffers

    • Consider on-column refolding for proteins recovered from inclusion bodies

    • Use size exclusion chromatography as a final polishing step

  • Protein stability issues:
    Challenge: Protein degradation during purification and storage
    Solutions:

    • Add protease inhibitors during extraction and purification

    • Maintain cold chain throughout the purification process

    • Store in buffer containing 6% Trehalose at pH 8.0

    • Aliquot and store at -20°C/-80°C to prevent freeze-thaw cycles

How can I optimize the design of recombinant OL3 constructs to maximize protein expression and functionality?

Optimizing recombinant OL3 construct design requires careful consideration of multiple factors:

  • Vector design optimization:

    • Select appropriate promoters for the expression system (phaseolin for seed-specific expression in plants)

    • Include optimal ribosome binding sites/Kozak sequences to enhance translation

    • Incorporate transcription terminators that ensure complete transcript formation

    • Consider including introns to potentially enhance expression in plant systems

  • Fusion tag position and selection:

    • For bacterial expression: His-tag has been successfully used with OL3 (2-141aa), typically at the N-terminus

    • For plant oil body expression: N-terminal fusions have been effective for oleosin-hEGF-hEGF

    • Consider the impact of the tag on protein folding and function

    • Include precise protease cleavage sites if tag removal is necessary

  • Linker design considerations:

    • Optimize linker length and composition between OL3 and fusion partners

    • Consider flexible linkers (Gly-Ser repeats) to minimize steric hindrance

    • For complex fusion proteins (e.g., oleosin-hEGF-hEGF), evaluate whether the linker affects the biological activity of the fusion partner

  • Codon optimization strategy:

    • Adapt codon usage to the expression host (E. coli for bacterial expression, plant-preferred codons for Arabidopsis)

    • Avoid rare codons, particularly in clusters

    • Remove potential cryptic splice sites when expressing in eukaryotic systems

    • Consider mRNA secondary structure at the 5' end, which can impact translation efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.