Recombinant Arabidopsis thaliana Oleosin 20.3 kDa (OL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
OL2; At3g27660; MGF10.7; Oleosin 20.3 kDa; Oleosin type 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-191
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OL2
Target Protein Sequence
ANVDRDRRVHVDRTDKRVHQPNYEDDVGFGGYGGYGAGSDYKSRGPSTNQILALIAGVPI GGTLLTLAGLTLAGSVIGLLVSIPLFLLFSPVIVPAALTIGLAVTGILASGLFGLTGLSS VSWVLNYLRGTSDTVPEQLDYAKRRMADAVGYAGMKGKEMGQYVQDKAHEARETEFMTET HEPGKARRGS
Uniprot No.

Target Background

Function

Oleosin 20.3 kDa (OL2) may play a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipases, facilitating lipolysis during seedling growth.

Database Links

KEGG: ath:AT3G27660

STRING: 3702.AT3G27660.1

UniGene: At.21549

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein.

Q&A

How is recombinant OL2 protein expressed and purified?

The recombinant expression and purification of Arabidopsis thaliana OL2 typically follows this methodology:

  • Expression system selection: E. coli is commonly used for recombinant OL2 expression, as seen in commercial preparations .

  • Construct design: The OL2 coding sequence (spanning amino acids 2-191) is fused to an N-terminal His-tag to facilitate purification .

  • Expression conditions: The protein is expressed in E. coli under optimal induction conditions (typically IPTG induction).

  • Purification process:

    • Bacterial cell lysis

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Further purification if needed (size exclusion chromatography)

    • Buffer exchange to a Tris/PBS-based buffer

  • Final preparation: The purified protein is often lyophilized with 6% trehalose at pH 8.0 for stability .

  • Quality control: SDS-PAGE analysis confirms purity (typically >90%) .

For reconstitution, it's recommended to centrifuge the vial briefly before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and add glycerol (final concentration 5-50%) before aliquoting for long-term storage at -20°C/-80°C .

What experimental models are used to study OL2 function in plant development?

Several experimental models and approaches are employed to investigate OL2 function:

  • Genetic knockout/knockdown models:

    • Single mutants: ol2 mutant plants show pointed leaves and shortened primary roots .

    • Multiple mutant combinations: ole1234 quadruple mutant (lacking OLE1, OLE2, OLE3, and OLE4) displays substantially larger and fewer lipid droplets than wild-type plants .

  • Overexpression models:

    • OL2 overexpressor lines exhibit heavier seeds, earlier germination, and longer primary roots compared to wild-type .

  • Visualization techniques:

    • Confocal microscopy with fluorescent dyes to monitor oil body dynamics in living embryos .

    • Tracking of oil body size and distribution in four dimensions (x, y, z, and time) .

  • Biochemical interaction studies:

    • Split-GFP-based bimolecular fluorescence complementation analysis to identify protein-protein interactions, such as between OL2 and BRX1-2 .

Research has revealed that ol2 mutants produce lighter seeds, show delayed germination, and develop fewer and shorter lateral roots compared to wild-type plants. Conversely, OL2 overexpression leads to heavier seeds, accelerated germination, and enhanced primary root development .

What phenotypes are associated with OL2 mutations in Arabidopsis?

OL2 mutations result in distinct phenotypic changes that illuminate its biological functions:

Phenotypic FeatureWild-Typeol2 MutantOL2 Overexpressor
Seed weightNormalLighterHeavier
Germination timingNormalDelayedEarlier
Leaf morphologyNormalPointed and serratedNo apparent change
Primary root lengthNormalShorterLonger
Lateral root developmentNormalFewer and shorterNot reported
Sugar sensitivityNormalHypersensitive to high concentrationsLess sensitive
Oil body characteristicsNormal size and distributionAltered size and distributionNot reported

Additional observations in ol2 mutants include:

  • The lateral root development phenotype resembles that of auxin-related mutants but is not enhanced by exogenous auxin application .

  • Oil bodies in seeds vary more in shape and size compared to wild-type plants .

  • Endoplasmic reticulum structure is altered, suggesting that OL2 contributes to normal ER organization .

These phenotypes demonstrate that OL2 influences various developmental processes, including seed formation, germination, and root development .

How do OL2 and other oleosins contribute to endoplasmic reticulum integrity?

Recent research using clickable ER-disrupting probes has revealed a previously unknown role for oleosins, including OL2, in maintaining endoplasmic reticulum integrity in Arabidopsis seedlings. The methodological approach and findings include:

  • Experimental approach:

    • Researchers used a clickable photoaffinity probe (designated as "2") that induces ER vesiculation

    • The probe was applied to Arabidopsis seedlings, followed by UV exposure for crosslinking

    • Cell lysates were separated into microsomal and soluble fractions

    • Click chemistry was performed with biotin tags for protein isolation and analysis

  • Key findings:

    • Probe "2" selectively labeled oleosins in microsomal fractions

    • Analysis of the ole1234 quadruple mutant (lacking OLE1, OLE2, OLE3, and OLE4) showed significantly reduced probe labeling in the 15-20 kDa range

    • The ole1234 mutant displayed abnormal ER structure

    • The strongest labeled ~15 kDa band corresponded to OLE1, while the ~20 kDa band corresponded to OLE2

  • Mechanism implications:

    • Both chemical (probe-induced) and genetic (mutation) perturbations of oleosins alter ER structure

    • Eroonazole (an ER-disrupting compound) induces vesiculation, which is dependent on oleosins

    • The effect is more pronounced in younger seedlings, consistent with the reduction of oleosin content as seedlings age

These findings suggest that oleosins, beyond their established role in oil body stabilization, are necessary for establishing and maintaining normal ER structure in seeds and seedlings. This represents a novel function for these proteins that extends beyond their canonical roles in lipid storage .

What methodologies are most effective for analyzing oil body dynamics in relation to OL2 function?

Advanced methodologies for studying oil body dynamics in relation to OL2 function combine imaging techniques, genetic manipulation, and computational analysis:

  • Four-dimensional imaging approach:

    • Fluorescent dyes (such as Nile Red) to label oil bodies in living embryos

    • Confocal microscopy to capture high-resolution images

    • Time-lapse imaging to track changes over developmental stages

    • Z-stack acquisition to capture three-dimensional data

    • Statistical analysis of oil body size and distribution in four dimensions (x, y, z, and time)

  • Genetic manipulation strategies:

    • Single mutants (ole1, ole2, etc.) to assess individual oleosin contributions

    • Multiple mutant combinations (e.g., ole1234 quadruple mutant) to address functional redundancy

    • Overexpression lines to evaluate gain-of-function effects

  • Quantitative analysis parameters:

    • Oil body size (diameter, volume)

    • Oil body number per cell/tissue

    • Oil body fusion events

    • Oil body surface-to-volume ratio

    • Spatial distribution patterns

Research using these approaches has revealed that OL2 and other oleosins influence oil body dynamics throughout seed development, with oil body size increasing during maturation (partly through fusion events) and then decreasing toward the end of the maturation process. The absence of specific oleosins alters these dynamics, resulting in fewer but larger oil bodies in mutant seeds .

For most effective analysis, researchers should combine multiple approaches and include appropriate controls (wild-type and related mutants) across multiple developmental timepoints to capture the dynamic nature of oil body formation and restructuring.

How can researchers address contradictory data when studying OL2 function?

When faced with contradictory data in OL2 research, researchers should implement a systematic approach to resolve discrepancies:

  • Methodological examination:

    • Scrutinize experimental methods for differences in:

      • Plant growth conditions (light, temperature, humidity)

      • Developmental stages examined

      • Sample preparation techniques

      • Analysis methods

    • Reproduce experiments under standardized conditions

  • Evaluate initial assumptions:

    • Review the hypothesis in light of all available data

    • Consider whether assumptions about OL2 function may be context-dependent

    • Examine whether functional redundancy with other oleosins may explain divergent results

  • Consider alternative explanations:

    • Analyze whether OL2 may have different functions in different tissues or developmental stages

    • Evaluate possible interactions with other proteins or environmental factors

    • Examine whether post-translational modifications might affect function

  • Integration strategies:

    • Use multiple complementary techniques to address the same question

    • Implement systematic controls to account for variables

    • Consider genetic background effects (especially important in Arabidopsis research)

  • Specific to OL2 research:

    • Address functional redundancy among oleosins by using multiple mutant combinations

    • Consider developmental timing, as oleosin expression changes dramatically during seed development and germination

    • Account for environmental conditions, as stress responses may alter oleosin functions

For example, research on the oli2 mutant revealed seemingly contradictory phenotypes: impaired growth during early development but enhanced drought and salt tolerance in adult plants. This apparent contradiction was resolved by recognizing that OL2 functions differently across developmental stages and stress conditions .

What are the best practices for designing experiments to study OL2 interactions with other proteins?

Designing robust experiments to investigate OL2 protein interactions requires careful planning and appropriate methodologies:

  • In vivo interaction methods:

    • Split-GFP bimolecular fluorescence complementation (BiFC):

      • Fuse potential interacting proteins to complementary GFP fragments

      • Co-express in Arabidopsis protoplasts or stable transgenic lines

      • Visualize interaction through fluorescence microscopy

      • Example: This approach successfully identified interaction between OL2 and BRX1-2, a nucleolar protein involved in rRNA processing

    • In planta photoaffinity labeling:

      • Use clickable photoaffinity probes that can crosslink to interacting proteins

      • Apply UV exposure to create covalent bonds between proximal proteins

      • Isolate labeled proteins through biotin-streptavidin purification

      • Identify interaction partners by mass spectrometry

      • Example: This method revealed OL2 as a target of eroonazole-based probes

  • In vitro confirmation methods:

    • Co-immunoprecipitation (Co-IP):

      • Express recombinant OL2 with epitope tag (His-tag common)

      • Incubate with potential interacting proteins

      • Precipitate OL2 and analyze co-precipitated proteins

      • Example: OL2 and BRX1-2 were shown to co-immunoprecipitate with APUM24

    • Pull-down assays:

      • Immobilize purified recombinant OL2 on appropriate matrix

      • Incubate with cell/tissue extracts or purified candidate proteins

      • Analyze bound proteins by Western blot or mass spectrometry

  • Experimental design considerations:

    • Include appropriate negative controls (non-interacting proteins, mutated versions)

    • Validate interactions using multiple independent methods

    • Consider subcellular localization (OL2 is found in oil bodies and associated with ER)

    • Account for developmental stage-specific interactions

    • Evaluate interaction under different conditions (stress, developmental stages)

  • Advanced interaction mapping:

    • Use deletion or point mutants to map interaction domains

    • Employ crosslinking mass spectrometry to identify interaction interfaces

    • Consider structural prediction methods to guide interaction studies

Research has demonstrated that OL2 interacts with BRX1-2, a nucleolar protein involved in rRNA processing for the large ribosomal subunit. Interestingly, overexpression of either OL2 or BRX1-2 leads to similar morphological changes, including extended plant lifespans, suggesting that these proteins function together in important developmental processes .

How does OL2 contribute to stress responses in Arabidopsis?

Research on OL2 and related proteins has revealed complex roles in plant stress responses through multiple mechanisms:

  • Stress response phenotypes in OL2-related mutants:

    • The SLO2 protein (an RNA editing factor affecting mitochondrial electron transport) shows interesting parallels with OL2 function

    • slo2 mutants exhibit:

      • Hypersensitivity to ABA and insensitivity to ethylene

      • Hypersensitivity to salt and osmotic stress during germination

      • Increased drought and salt tolerance in adult plants

      • Greater susceptibility to pathogen infection (Botrytis cinerea)

    • Similarly, oli2 mutants show:

      • Altered sugar sensitivity (hypersensitive to high concentrations)

      • Germination and early development defects

      • Phenotypic similarities to auxin-related mutants

  • Molecular mechanisms linking OL2 to stress responses:

    • OL2 and other oleosins stabilize oil bodies, which serve as energy reserves during stress

    • Altered oil body dynamics in ol2 mutants may affect energy mobilization during stress

    • OL2 may contribute to ER integrity, which is crucial for stress response

    • Connection to ribosome biogenesis factors suggests potential roles in stress-responsive protein synthesis

  • Experimental approaches to study OL2 in stress responses:

    • Physiological assays:

      • Seed germination under osmotic/salt stress conditions

      • Drought tolerance tests in adult plants

      • Root growth assays under various stress conditions

    • Molecular analyses:

      • Expression profiling of stress-responsive genes in ol2 mutants

      • Analysis of stress hormone responses (ABA, ethylene)

      • Examination of ROS accumulation and antioxidant systems

  • Integration with developmental processes:

    • OL2 functions may vary across developmental stages

    • Early developmental defects in ol2 mutants may trigger compensatory mechanisms that enhance stress tolerance in adult plants

    • The interaction between OL2 and BRX1-2 suggests links to ribosome biogenesis, which is regulated during stress responses

Understanding OL2's role in stress responses requires integrating data from developmental biology, cell biology, and molecular physiology to discern direct effects from adaptive responses to developmental alterations.

What are the latest advances in utilizing OL2 in biotechnology applications?

Recent research has revealed promising biotechnology applications for OL2 and oleosin-based systems:

  • Molecular pharming platform:

    • Oleosin fusion technology for recombinant protein production:

      • Oleosin genes (including OL2) can be fused to target proteins

      • The recombinant fusion proteins accumulate in oil bodies

      • This provides an inexpensive and scalable platform for purification

      • Example: Oleosin-hEGF-hEGF fusion protein expressed in transgenic Arabidopsis

    • Advantages of the system:

      • Oil bodies are easily isolated by flotation centrifugation

      • The system allows for simplified downstream processing

      • Proteins fused to oleosins often retain biological activity

      • Example: Oleosin-hEGF-hEGF stimulated NIH/3T3 cell proliferation

  • Transdermal delivery applications:

    • Oil body-based delivery systems:

      • Oil bodies expressing oleosin fusion proteins can penetrate skin

      • Smaller transgenic oil bodies expressing recombinant proteins are more skin-permeable

      • Immunohistochemical staining can track the penetration process

      • Example: Oil bodies expressing oleosin-hEGF-hEGF showed greater staining intensity than free EGF in transdermal absorption tests

  • Experimental design for oleosin fusion systems:

    • Construct design:

      • Oleosin gene (such as OL2) concatenated to target gene(s)

      • Use of plant-preferred codons for optimal expression

      • Selection of appropriate promoters (e.g., phaseolin promoter for seed-specific expression)

      • Incorporation of tags for detection and purification if needed

    • Expression quantification:

      • RT-PCR for transcript validation

      • Western blot for protein quantification

      • Activity assays to confirm functionality

      • Example: Oleosin-hEGF-hEGF expression level reached 14.83 ng/μL in transgenic Arabidopsis seeds

  • Future directions:

    • Development of optimized OL2 variants for specific applications

    • Expansion to diverse therapeutic and industrial proteins

    • Combination with other technologies for enhanced delivery or production

    • Scale-up strategies for commercial applications

These advances demonstrate the potential of OL2 and oleosin-based systems as versatile platforms for recombinant protein production and delivery, particularly for applications requiring simplified purification processes or enhanced transdermal absorption .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.