Recombinant Arabidopsis thaliana Omega-3 fatty acid desaturase, endoplasmic reticulum (FAD3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Omega-3 Fatty Acid Desaturase, Endoplasmic Reticulum (FAD3)

Arabidopsis thaliana Omega-3 Fatty Acid Desaturase, Endoplasmic Reticulum (FAD3) is an enzyme that plays a vital role in plant lipid metabolism . Specifically, FAD3 is a fatty acid desaturase that introduces a double bond into fatty acids, converting n-6 fatty acids into n-3 polyunsaturated fatty acids (PUFAs) . It is localized in the endoplasmic reticulum (ER) of plant cells .

Gene Identification and Function

The gene that encodes the FAD3 enzyme is identified as Gene ID: 817548 in Arabidopsis thaliana . The FAD3 gene product is responsible for converting saturated fatty acids, which have single bonds between carbon atoms, into unsaturated fatty acids, which have double bonds . Specifically, FAD3 converts linoleic acid (LA, an n-6 fatty acid) to α-linolenic acid (ALA, an n-3 fatty acid) .

Protein Production and Availability

Recombinant forms of Arabidopsis thaliana Omega-3 fatty acid desaturase, endoplasmic reticulum (FAD3) can be produced in various expression systems, including yeast, E. coli, baculovirus, and mammalian cells . These recombinant proteins are often used in research to study the enzyme's function and characteristics .

FAD3 Interaction with Other Desaturases

FAD3 can interact with other fatty acid desaturases, such as FAD2, to form heterodimers . FAD2 is another desaturase localized in the endoplasmic reticulum . When FAD2 and FAD3 are co-expressed, they can form FAD2-FAD3 heterodimers, which facilitates the channeling of oleate to α-linolenic acid without releasing the linoleic acid intermediate .

Impact on Fatty Acid Synthesis

Research indicates that the co-expression of FAD2 and FAD3 in transgenic mice can significantly alter the fatty acid composition in various tissues . For instance, Fad2–Fad3 double transgenic mice exhibited a lower n-6/n-3 ratio compared to wild-type mice, indicating that the Fad2 and Fad3 genes are functionally expressed and can establish PUFA biosynthetic pathways .

The levels of n-3 PUFAs were also increased in major tissues of Fad2–Fad3 mice compared with Fad3 single transgenic mice, suggesting that the FAD3 enzyme plays an active role in converting n-6 into n-3 PUFAs .

Transgenic Mouse Studies

Transgenic mouse studies have provided substantial insights into the function and impact of FAD3 on fatty acid metabolism . For example, researchers generated Fad3 transgenic mice to assess the potential expression of the Fad3 gene in vivo . The Fad3 mRNA was detected in various tissues, including skeletal muscle, fat, heart, liver, spleen, lung, and kidney .
Gas chromatographic analysis revealed that F0 Fad3 transgenic mice had higher amounts of n-3 PUFAs and lower amounts of n-6 PUFAs compared to wild-type mice .

Key Findings from Research

FeatureFAD3 Transgenic MiceFad2–Fad3 Double Transgenic Mice
n-3 PUFA ContentIncreased in various tissues compared to wild-type mice Significantly increased compared to wild-type and FAD3 mice
n-6 PUFA ContentDecreased in various tissues compared to wild-type mice Increased compared to wild-type mice, but lower n-6/n-3 ratio
n-6/n-3 RatioReduced compared to wild-type mice Substantially lower in all tissues examined compared to wild-type mice
Fatty Acid Synthesis Genes-Significantly decreased (Fasn, Scd1, and Acc)
Fatty Acid-Binding Protein-Increased (Fabp4)
Fatty Acid Oxidation Genes-Increased (Lipe, Lpl, Ppar-γ, Lcad)

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format preferences in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to concentrate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAD3; At2g29980; F23F1.10; Acyl-lipid omega-3 desaturase; cytochrome b5, endoplasmic reticulum; Omega-3 fatty acid desaturase 3, endoplasmic reticulum
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-386
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAD3
Target Protein Sequence
MVVAMDQRTNVNGDPGAGDRKKEERFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSYVV RDIIAVAALAIAAVYVDSWFLWPLYWAAQGTLFWAIFVLGHDCGHGSFSDIPLLNSVVGH ILHSFILVPYHGWRISHRTHHQNHGHVENDESWVPLPERVYKKLPHSTRMLRYTVPLPML AYPLYLCYRSPGKEGSHFNPYSSLFAPSERKLIATSTTCWSIMFVSLIALSFVFGPLAVL KVYGVPYIIFVMWLDAVTYLHHHGHDEKLPWYRGKEWSYLRGGLTTIDRDYGIFNNIHHD IGTHVIHHLFPQIPHYHLVDATKAAKHVLGRYYREPKTSGAIPIHLVESLVASIKKDHYV SDTGDIVFYETDPDLYVYASDKSKIN
Uniprot No.

Target Background

Function

Function: Arabidopsis thaliana Microsomal (ER) omega-3 fatty acid desaturase introduces the third double bond in the biosynthesis of 18:3 fatty acids, crucial components of plant membranes. It is believed to utilize cytochrome b5 as an electron donor and to act on fatty acids esterified to phosphatidylcholine and potentially other phospholipids.

Gene References Into Functions

Related Research:

  1. GCN5's role in acetylating FAD3 and influencing fatty acid composition in Arabidopsis thaliana seeds. PMID: 27500884
  2. ALA10's interaction with FAD2 and its impact on phosphatidylcholine fatty acyl desaturation. PMID: 26620528
  3. SAD6 and FAD3's collaborative increase in unsaturated fatty acids under hypoxia and drought. PMID: 24368335
  4. FAD2 and FAD3 desaturase heterodimer formation and its role in metabolic channeling. PMID: 24811169
  5. bZIP67's binding to FAD3 promoter G-boxes and its enhancement of FAD3 expression. PMID: 23995083
  6. Increased FAD3 dosage and its effect on linolenic acid content in seed oil. PMID: 21848868
  7. Membrane lipid fatty acid composition's influence on cell growth, mitochondrial respiration, and alternative oxidase expression under cold stress. PMID: 17507388
  8. Mangiferic acid production through fatty acid n-3 desaturase overexpression. PMID: 19548018
Database Links

KEGG: ath:AT2G29980

STRING: 3702.AT2G29980.1

UniGene: At.271

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Abundant in leaves and seedlings. Barely detectable in root tissue.

Q&A

What is the biological function of FAD3 in Arabidopsis thaliana?

FAD3 is an endoplasmic reticulum (ER) membrane-bound omega-3 fatty acid desaturase that catalyzes the introduction of a third double bond into linoleic acid (18:2) to produce linolenic acid (18:3). It plays a crucial role in the biosynthesis of polyunsaturated fatty acids (PUFAs) that accumulate in seed storage oil. The enzyme is essential for maintaining appropriate levels of trienoic fatty acids under various conditions, particularly low temperatures .

FAD3 works by desaturating linoleate esterified to phosphatidylcholine of the endoplasmic reticulum. This is part of the lipid remodeling process that involves 'acyl editing' - a process involving desaturation of acyl groups followed by a rapid deacylation-reacylation cycle that exchanges fatty acids from phosphatidylcholine with fatty acids from the acyl-CoA pool .

How does the structure of FAD3 compare to other desaturases?

FAD3 shows structural similarity to both FAD2 (delta-12 desaturase) and other membrane-bound desaturases. When compared with Arabidopsis FAD2, FAD3 exhibits approximately 35% sequence identity and 61% similarity. Comparison with other FAD3 enzymes reveals 32% sequence identity and 54% similarity .

Key structural features include:

  • The presence of eight conserved histidine residues (positions 123, 127, 159, 162, 163, 324, 327, and 328 in related sequences) that are highly conserved among all membrane desaturases

  • Three hydrophobic regions that likely represent membrane-spanning domains

  • A cytoplasmic N-terminal domain containing catalytic residues

The FAD3 protein, like other ER-type desaturases, relies on cytochrome b5 and cytochrome b5 reductase to supply electrons from NAD(P)H for the desaturation reaction .

What are the best approaches for studying FAD3 function in transgenic plants?

To study FAD3 function in transgenic plants, several methodological approaches have proven effective:

Overexpression Studies:

  • Clone the FAD3 cDNA into a plant expression vector under the control of a suitable promoter (seed-specific promoters like vicilin are effective for seed-targeted expression)

  • Transform plants using Agrobacterium-mediated transformation

  • Select transgenic lines using appropriate selection markers

  • Analyze fatty acid composition in transgenic lines compared to wild-type plants

Tissue-Specific Expression Analysis:

  • For studying FAD3 function in different tissues, use tissue-specific promoters

  • Root tissues often show clearer phenotypes as they lack the chloroplast desaturases (encoded by FAD6, FAD7, and FAD8) that can mask phenotypes in leaf tissue

Complementation Studies:

  • Use FAD3 mutants (such as fad3 mutants with reduced linolenic acid content)

  • Transform with wild-type or modified FAD3 constructs

  • Analyze fatty acid profiles to assess functional complementation

An example experimental design used in a successful study :

  • A cDNA encoding the Arabidopsis extraplastidic linoleate desaturase (FAD3) was cloned

  • The construct was introduced into wild-type Arabidopsis and a high-oleate mutant line

  • Transformants were selected and screened for fatty acid composition

  • Results showed linolenic acid increased from 19% to nearly 40% of total seed fatty acids in wild-type plants, with corresponding decrease in linoleate content

How should experimental designs be optimized to study the interaction between FAD3 and environmental conditions?

For studying FAD3 interaction with environmental conditions such as temperature stress:

Factorial Design Approach:
Implement a complete factorial design that systematically tests:

  • Temperature conditions (multiple levels from optimal to stress conditions)

  • Genotype (wild-type, FAD3 overexpressors, fad3 mutants)

  • Developmental stage

  • Duration of stress exposure

This approach allows for identification of both main effects (from each independent factor) and interaction effects when multiple factors influence the outcome .

Example of an optimized factorial design:

  • Select multiple genotypes (wild-type, fad3 mutant, FAD3 overexpressor lines)

  • Grow plants under controlled conditions to eliminate confounding variables

  • Apply temperature treatments at defined developmental stages (e.g., 24°C, 10°C, 4°C, 0°C)

  • Measure multiple response variables:

    • Fatty acid composition

    • Membrane fluidity

    • Gene expression changes

    • Physiological responses (photosynthetic efficiency, growth parameters)

  • Include appropriate biological replicates (minimum n=3) for statistical validity

  • Include recovery treatments to assess reversibility of responses

When analyzing results, ensure calculation of both main effects and interaction terms, as temperature effects on FAD3 activity may be non-linear or dependent on developmental stage .

How should researchers analyze and interpret changes in fatty acid profiles resulting from FAD3 manipulation?

Analysis of fatty acid profiles requires rigorous quantitative approaches:

Analytical Methodology:

  • Extract total lipids from tissue samples using standardized protocols

  • Prepare fatty acid methyl esters (FAMEs) for gas chromatography analysis

  • Use gas chromatography-mass spectrometry (GC-MS) for accurate identification and quantification

  • Calculate the relative proportions of individual fatty acids as percentage of total fatty acids

  • For FAD3 activity estimation, calculate omega-3 desaturation index using the formula:
    ω-3 Desaturation (%) = [18:3/(18:2 + 18:3)] × 100

Interpretation Guidelines:

  • Compare changes in both absolute amounts and relative proportions of fatty acids

  • Examine specific lipid classes separately (phospholipids, galactolipids, neutral lipids)

  • Consider the balance between omega-3 and omega-6 fatty acids

  • Account for potential compensatory changes in other fatty acids

  • Correlate fatty acid changes with phenotypic observations

Example of data interpretation:
In a study of soybean FAD3 desaturation activity, the researchers observed dramatic differences in omega-3 desaturation rates between genotypes:

Table 1. Fatty acid composition and relative ω-3 fatty acid desaturase activity in contrasting genotypes.

GenotypeLinoleic Acid (18:2) (g/kg)Linolenic Acid (18:3) (g/kg)ω-3 Desaturation (%)
RG10693243.4
PI 361088B635547.8
OX94849612820.5

These data reveal that the low levels of linolenic acid in RG10 and PI 361088B are direct results of low ω-3 fatty acid desaturation activity (3.4% and 7.8%, respectively), while the much higher level in the wild-type line (OX948) results from 20.5% relative ω-3 FAD activity .

How can researchers address contradictions in experimental data when studying FAD3 function?

When confronted with contradictory results in FAD3 research:

Systematic Troubleshooting Approach:

  • Validate experimental techniques:

    • Confirm the specificity and sensitivity of analytical methods

    • Verify transgene insertion and expression levels using RT-PCR and Western blotting

    • Check for silencing effects in transgenic lines

  • Consider biological variables:

    • Developmental stage differences can significantly impact FAD3 expression

    • Growth conditions (temperature, light, nutrients) affect desaturase activity

    • Tissue-specific expression patterns may vary

  • Analyze substrate availability:

    • FAD3 activity depends on substrate (18:2) availability

    • Evaluate the entire fatty acid biosynthesis pathway

    • Consider bottlenecks in substrate provision

  • Address experimental design limitations:

    • Ensure appropriate controls and replicates

    • Consider the impact of positional effects in transgenic lines

    • Exclude lines with multiple insertions that may cause inconsistent results

Example resolution of contradictory data:
In studies examining FAD3 overexpression, researchers observed variable levels of EPA accumulation across different transgenic lines. The T2 generation produced only 0.2% EPA (of total fatty acids), while selected T3 lines showed up to 0.4% EPA - a twofold increase. This apparent contradiction was resolved by recognizing that:

How can FAD3 be engineered for enhanced functional properties in transgenic plants?

Engineering FAD3 for enhanced functionality requires sophisticated molecular approaches:

Structure-Function Based Modifications:

  • Protein engineering strategies:

    • Site-directed mutagenesis of conserved histidine residues to modify catalytic efficiency

    • Domain swapping with other desaturases to alter substrate specificity

    • N-terminal modifications to enhance protein stability or membrane integration

  • Expression optimization:

    • Codon optimization for target plant species

    • Use of tissue-specific or inducible promoters

    • Co-expression with genes encoding electron transport components (cytochrome b5)

  • Targeting modifications:

    • Addition of subcellular targeting sequences to direct FAD3 to specific compartments

    • Fusion with membrane-anchoring domains to enhance ER retention

Practical Example:
One successful approach involved the introduction of multiple genes to reconstitute the entire omega-3 LC-PUFA pathway in Arabidopsis. The system included:

  • FAD3 for conversion of 18:2 to 18:3

  • Additional elongases and desaturases for EPA and DHA synthesis

The iterative approach allowed for successive improvements:

  • Initial EPA yields of approximately 0.2% in T2 plants

  • Selection of optimal lines with enhanced pathway function

  • Achievement of EPA levels at 0.4% and DHA at levels 10-fold higher than previously reported

What are the most effective experimental designs for studying the regulatory mechanisms controlling FAD3 expression?

To study FAD3 regulatory mechanisms, implement these advanced experimental designs:

Transcriptional Regulation Analysis:

  • Promoter dissection approach:

    • Generate a series of promoter deletion constructs fused to reporter genes

    • Transform plants and analyze reporter gene expression under various conditions

    • Identify key cis-regulatory elements through deletion/mutation analysis

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors

  • Hormone response profiling:

    • Implement a complete factorial design testing multiple hormones at different concentrations

    • Analyze FAD3 expression using RT-qPCR across time points

    • Verify hormone signaling using appropriate marker genes

Post-Transcriptional Regulation:

  • RNA stability assays:

    • Treat tissues with transcriptional inhibitors

    • Measure FAD3 mRNA decay rates under different conditions

    • Identify regulatory RNA-binding proteins using RNA immunoprecipitation

Environmental Response Analysis:
Use split-plot experimental designs when investigating factors that are difficult to change (like temperature) alongside easily manipulated factors (like genotype) . This approach:

  • Controls for block effects

  • Maximizes statistical power for interactions of interest

  • Enables proper attribution of variance components

Example from research:
Studies on cold stress response revealed that phytohormones regulate FAD3 expression in a complex manner. Jasmonic acid and brassinosteroids were found to participate in cold-responsive expression of omega-3 FAD genes in both suspension-cultured cells and leaves. In leaves, the regulation was more complex with additional participation of abscisic acid and gibberellin .

What are the critical factors affecting recombinant FAD3 stability and activity in experimental systems?

Several critical factors affect recombinant FAD3 stability and activity:

Storage and Handling Parameters:

  • Temperature: Optimal storage at -20°C/-80°C (shelf life of 6 months for liquid form, 12 months for lyophilized form)

  • Avoid repeated freezing and thawing cycles

  • Working aliquots should be stored at 4°C for no more than one week

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol (final concentration) recommended for long-term storage

Expression System Considerations:

  • Host selection:

    • Mammalian cell expression systems often provide proper post-translational modifications

    • Plant expression systems maintain native folding environment

    • Yeast systems balance yield with proper membrane integration

  • Protein preparation factors:

    • Purification method impacts final activity (detergent selection is critical)

    • Purity level (>85% by SDS-PAGE is standard for functional studies)

    • Presence of appropriate cofactors (Fe, cytochrome b5)

  • Assay conditions:

    • Substrate presentation (free fatty acids vs. phospholipid-incorporated)

    • Reaction buffer composition (pH, ionic strength)

    • Electron donor systems availability

How can researchers optimize experiments to investigate the role of FAD3 in plant stress responses?

To investigate FAD3's role in stress responses, implement these optimized experimental approaches:

Stress Exposure Protocols:

  • Temperature stress optimization:

    • Implement gradual temperature changes to simulate natural conditions

    • Monitor both short-term (hours) and long-term (days/weeks) responses

    • Include recovery periods to assess adaptation potential

    • Compare responses in different tissues (roots often show clearer effects)

  • Combined stress experiments:

    • Design factorial experiments that test multiple stresses simultaneously

    • Include appropriate controls for each individual stress

    • Measure multiple response variables (fatty acid profiles, membrane fluidity, gene expression)

Genetic Approach Optimization:

  • Mutant selection strategy:

    • Use both knockout/knockdown and overexpression lines

    • Include tissue-specific or inducible expression systems

    • Analyze multiple independent transgenic lines to control for position effects

  • Phenotyping protocols:

    • Implement standardized growth conditions

    • Use automated phenotyping platforms when available

    • Measure both morphological and physiological parameters

Example optimized methodology:
In a study investigating the role of omega-3 FADs in cold stress response in Chorispora bungeana, researchers optimized their experimental approach by:

  • Cloning two plastidial ω-3 desaturase genes (CbFAD7, CbFAD8) and verifying them in an Arabidopsis fad7fad8 double mutant

  • Comparing their function with the microsomal ω-3 desaturase gene (CbFAD3)

  • Testing expression patterns across different tissues and temperature conditions

  • Implementing a hormone treatment matrix to identify regulatory mechanisms

This optimized approach revealed that low temperatures resulted in significant increases in trienoic fatty acids (TAs) through the cooperation of CbFAD3 and CbFAD8 in cultured cells, and the coordination of CbFAD7 and CbFAD8 in leaves .

How can FAD3 research contribute to understanding plant adaptation to environmental stresses?

FAD3 research provides critical insights into plant stress adaptation mechanisms:

Membrane Fluidity Regulation:

  • FAD3 increases membrane unsaturation under cold stress, maintaining membrane fluidity

  • This mechanism represents a fundamental adaptation strategy across plant species

  • Quantitative analysis shows correlation between unsaturation levels and stress tolerance

Signaling Pathway Integration:

  • FAD3 activity impacts the production of signaling molecules derived from polyunsaturated fatty acids

  • These compounds function in stress-responsive pathways including jasmonate signaling

  • The regulatory networks connecting FAD3 to hormone responses offer insights into stress adaptation mechanisms

Evolutionary Significance:

  • Comparative analysis of FAD3 across species reveals adaptive patterns

  • Studies of natural variation in FAD3 alleles can identify beneficial traits for crop improvement

  • Understanding the co-evolution of FAD3 with other stress response pathways informs evolutionary biology

Research Impact Example:
Studies in Arabidopsis have shown that phytohormones regulate the tissue-specific expression of FAD3 genes under cold stress. This regulation involves jasmonic acid and brassinosteroids in both suspension-cultured cells and leaves, with additional participation of abscisic acid and gibberellin in leaves . These findings demonstrate the sophisticated integration of FAD3 function with broader hormone signaling networks that govern plant stress responses.

What are the most promising research directions for harnessing FAD3 in agricultural applications?

Promising research directions for FAD3 include:

Crop Improvement Strategies:

  • Engineering climate resilience:

    • Targeted modification of FAD3 expression for enhanced cold/drought tolerance

    • Development of temperature-responsive FAD3 expression systems

    • Stacking FAD3 modifications with other stress tolerance traits

  • Nutritional enhancement:

    • Iterative optimization approaches for increasing omega-3 fatty acid content

    • Tissue-specific FAD3 expression to target edible plant parts

    • Combining FAD3 with additional desaturases and elongases for EPA/DHA production

Advanced Methodological Approaches:

  • CRISPR-based gene editing:

    • Precise modification of FAD3 regulatory regions

    • Creation of allelic series with varying activity levels

    • Multiplex editing of FAD3 with related pathway genes

  • High-throughput phenotyping:

    • Development of rapid screening methods for FAD3 activity

    • Integration of lipidomic analysis with physiological phenotyping

    • Field-based sensors for monitoring membrane parameters

Example of promising research direction:
An iterative approach to optimizing non-native long-chain polyunsaturated fatty acids in transgenic plants was undertaken in Arabidopsis, beginning with FAD3 to establish the omega-3 pathway. This systematic approach:

  • Determined the contribution of different transgene enzyme activities

  • Assessed the impact of endogenous fatty acid metabolism

  • Used lipidomic analysis of neutral, polar, and acyl-CoA pools to inform successive iterations

This approach allowed for a four-fold improvement in EPA accumulation and facilitated engineering of DHA to 10-fold higher levels than previously reported .

What are the best practices for designing control groups in FAD3 functional studies?

Rigorous control design is essential for FAD3 functional studies:

Genetic Control Design:

  • Null/empty vector controls:

    • Plants transformed with empty vectors to control for transformation effects

    • Expression of non-functional protein (e.g., with mutated catalytic site) to control for protein accumulation effects

  • Multiple independent transgenic lines:

    • Minimum of 3-5 independent lines to control for positional effects

    • Selection of lines with similar expression levels for direct comparison

    • Inclusion of homozygous and hemizygous lines to assess dosage effects

  • Appropriate genetic backgrounds:

    • Wild-type parental lines

    • Related desaturase mutants (e.g., fad2, fad7, fad8)

    • Multiple ecotypes/accessions to assess genetic background effects

Environmental Control Design:

  • Growth condition standardization:

    • Controlled growth chambers with defined light, temperature, and humidity

    • Randomized block design to minimize position effects

    • Staggered planting to ensure developmental synchronization

  • Tissue sampling controls:

    • Sampling at defined developmental stages rather than chronological age

    • Collection at consistent times of day to control for diurnal effects

    • Processing of all samples simultaneously to minimize batch effects

Example best practice:
In a study analyzing FAD3 overexpression in Arabidopsis, researchers implemented these control measures:

  • Transformed both wild-type plants and a high-oleate mutant line

  • Selected multiple independent transgenic lines

  • Used the seed-specific vicilin promoter to limit expression to seeds

  • Analyzed fatty acid composition in the T2 and T3 generations to confirm stability

  • Included empty vector controls to account for transformation effects

How should researchers standardize analytical methods for detecting and quantifying FAD3-mediated changes in lipid profiles?

Standardized analytical methods are critical for reliable FAD3 research:

Sample Preparation Protocol:

  • Tissue collection standardization:

    • Harvest at consistent developmental stages

    • Flash-freeze samples immediately in liquid nitrogen

    • Store at -80°C until extraction to prevent degradation

  • Lipid extraction optimization:

    • Use established methods (e.g., Bligh and Dyer or Folch)

    • Include internal standards for each lipid class

    • Maintain samples at 4°C during extraction to prevent oxidation

    • Perform extractions under nitrogen to prevent auto-oxidation

Analytical Method Standardization:

  • Chromatography parameters:

    • Gas chromatography: Use polar columns (e.g., DB-23, SP-2330) for optimal FAME separation

    • HPLC: Implement reverse-phase separation with C18 columns for intact lipids

    • Include certified reference materials for retention time validation

  • Mass spectrometry settings:

    • Implement multiple reaction monitoring (MRM) for targeted analysis

    • Use high-resolution MS for comprehensive lipidomics

    • Develop standardized ion libraries for consistent peak identification

Data Processing and Reporting:

  • Quantification approach:

    • Report both absolute quantities (using calibration curves) and relative percentages

    • Calculate derived metrics such as:

      • Unsaturation index = Σ(% fatty acid × number of double bonds)

      • ω-3 desaturation index = [18:3/(18:2 + 18:3)] × 100

  • Statistical analysis standardization:

    • Implement appropriate transformations for percentage data (arcsine)

    • Use mixed models to account for random effects

    • Correct for multiple comparisons in comprehensive analyses

Example standardized approach:
In a study examining FAD3 activity, researchers implemented a standardized half-seed technique:

  • Approximately one-third of the cotyledon tissue distal from the embryonic axis was used for fatty acid analyses

  • The remainder of the seed containing the embryo was planted for the next generation

  • Fatty acid compositions were determined by gas liquid chromatography of fatty acid methyl esters (g/kg)

  • 10 half-seeds were bulked per parental line and for each RIL

  • ω-3 FAD activity was calculated as: [(18:3)/(18:2 + 18:3)] × 100

  • Statistical analysis used Proc Mix protocol in SAS

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.