Recombinant Arabidopsis thaliana Omega-6 fatty acid desaturase, endoplasmic reticulum (FAD2)

Shipped with Ice Packs
In Stock

Description

Fatty Acid Biosynthesis

  • Catalyzes Δ12-desaturation of oleic acid to linoleic acid in ER-synthesized phospholipids .

  • Converts 18:1 to 18:2, increasing PUFA content by 30–50% in wild-type plants compared to fad2 mutants .

Stress Adaptation

  • Cold tolerance: Upregulated under low temperatures, enhancing membrane fluidity via increased 18:2 levels .

  • Salt tolerance: fad2 mutants exhibit hypersensitivity to NaCl stress due to reduced 18:2 and disrupted ion homeostasis .

  • ER stress resilience: Maintains ER membrane integrity by balancing 18:1 and 18:2 ratios, as shown in tunicamycin-treated mutants .

Transcriptional Control

  • Promoter elements: Contains MYC (low-temperature), MYB (dehydration), and WRKY71OS (GA signaling) motifs .

  • Expression patterns:

    TissueExpression LevelConditions
    RootsHighSalt stress, ABA treatment
    Developing seedsModerateNormal growth
    LeavesLowCold stress, JA signaling
  • Induced by abscisic acid (ABA), brassinosteroids (24-eBL), and salicylic acid (SA), but suppressed by sucrose .

Post-Translational Modifications

  • Interacts with cytochrome b5 reductase for electron transfer during desaturation .

  • Mutations in histidine motifs (e.g., A104T) abolish enzymatic activity, leading to dwarf phenotypes and reduced 18:2 levels .

Metabolic Engineering

  • Overexpression in yeast (Saccharomyces cerevisiae) and Brassica napus increases linoleic acid production by 40–60% .

  • Used to develop cold-tolerant crops via CRISPR/Cas9-mediated editing of FAD2 homologs .

Industrial Relevance

  • Key target for modifying seed oil composition in oilseed crops (e.g., soybean, sunflower) .

  • Enhances biofuel feedstock quality by optimizing PUFA profiles .

Key Research Findings

  1. Mutant Phenotypes:

    • fad2 mutants show 70% reduction in 18:2 and accumulate 18:1 in seeds .

    • Exhibited dwarfism and impaired germination under stress .

  2. Complementation Studies:

    • Expression of recombinant FAD2 in mutants restored wild-type fatty acid profiles and stress tolerance .

  3. Evolutionary Insights:

    • Gene duplication events in FAD2 family (e.g., AsFAD2 in Anabasis) correlate with adaptive radiation in arid environments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
FAD2; At3g12120; T21B14.6; T21B14_107; T23B7.6; Delta(12-fatty-acid desaturase; Fatty acid desaturase 2; Omega-6 fatty acid desaturase, endoplasmic reticulum
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FAD2
Target Protein Sequence
MGAGGRMPVPTSSKKSETDTTKRVPCEKPPFSVGDLKKAIPPHCFKRSIPRSFSYLISDI IIASCFYYVATNYFSLLPQPLSYLAWPLYWACQGCVLTGIWVIAHECGHHAFSDYQWLDD TVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKQKSAIKWYGKYLNNPLGRIM MLTVQFVLGWPLYLAFNVSGRPYDGFACHFFPNAPIYNDRERLQIYLSDAGILAVCFGLY RYAAAQGMASMICLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDRD YGILNKVFHNITDTHVAHHLFSTMPHYNAMEATKAIKPILGDYYQFDGTPWYVAMYREAK ECIYVEPDREGDKKGVYWYNNKL
Uniprot No.

Target Background

Function

Arabidopsis thaliana recombinant omega-6 fatty acid desaturase (FAD2), a microsomal (ER) enzyme, catalyzes the introduction of the second double bond in the biosynthesis of 18:3 fatty acids, crucial components of plant membranes. This delta(12)-desaturase exhibits regioselectivity based on the substrate's double bond (delta(9) position) and carboxyl group. It utilizes both 16:1 and 18:1 fatty acids as substrates, likely employing cytochrome b5 as an electron donor and acting on fatty acids esterified to phosphatidylcholine (PC) and potentially other phospholipids. It displays minimal constitutive hydroxylation activity. FAD2 is essential for desaturating fatty acids in extraplastidial membranes, including mitochondria, and plays a critical role in salt tolerance during seed germination and early seedling development.

Gene References Into Functions
  1. Studies indicate that omega-6 desaturation is largely regulated by cis-acting sequence variations within the FAD2 5' untranslated region intron, influencing gene expression levels. PMID: 28108698
  2. FAD2 and FATB genes may have influenced the adaptive evolution of seed oil composition, optimizing seed oil melting points relative to germination temperatures. PMID: 26865732
  3. Research suggests that FAD2-mediated, high-level vacuolar and plasma membrane fatty acid desaturation is crucial for the proper function of membrane-bound Na+/H+ exchangers. PMID: 22279586
Database Links

KEGG: ath:AT3G12120

STRING: 3702.AT3G12120.1

UniGene: At.23898

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in shoots and roots. Expressed in leaves, stems, flowers and siliques.

Q&A

What is the molecular structure of FAD2 and how does it relate to its desaturase function?

FAD2 is a membrane-bound desaturase containing 6 transmembrane domains and 8 conserved histidine residues arranged in three distinct clusters (HXXXH, HXXHH, and HXXHH). These histidine clusters form iron-binding domains that are essential for the reduction of oxygen during the desaturation process .

The third histidine cluster contains four hydrophobic residues (valine, alanine, leucine, valine) among its eight amino acids, suggesting these hydrophobic residues may be located within the active site of the enzyme. The second histidine cluster is particularly rich in leucine residues . This specific arrangement of transmembrane domains and histidine-rich motifs creates the catalytic environment necessary for FAD2 to convert oleic acid (18:1) to linoleic acid (18:2) by introducing a second double bond at the Δ12 position.

When analyzing FAD2 structure-function relationships, researchers should focus on these conserved domains while considering that even minor amino acid substitutions within these regions can significantly alter substrate specificity and catalytic efficiency.

How does FAD2 differ from other plant fatty acid desaturases like FAD6?

While both FAD2 and FAD6 catalyze the conversion of oleic acid to linoleic acid by introducing a double bond at the Δ12 position, they differ in several crucial aspects:

  • Subcellular localization: FAD2 is primarily localized to the endoplasmic reticulum (microsomal), whereas FAD6 is chloroplastic .

  • Expression patterns: FAD2 often shows tissue-specific expression patterns, with certain isoforms (particularly FAD2-1) being seed-specific, while others (like FAD2-2) are constitutively expressed throughout the plant. FAD6 typically shows more consistent expression across tissues .

  • Evolutionary origin: FAD2 and FAD6 evolved independently and belong to different desaturase families, despite catalyzing similar reactions. FAD2 is more closely related to other ER-bound desaturases .

  • Response to environmental stimuli: FAD2 and FAD6 often show differential regulation under stress conditions. For example, in olive drupes under cold stress, FAD2.2 expression increases while FAD6 expression decreases .

When designing experimental systems to study these enzymes, researchers must account for these differences in localization and regulation to ensure appropriate expression systems and cellular contexts.

What is the evolutionary history of the FAD2 gene family in plants?

The FAD2 gene family has undergone significant diversification throughout plant evolution, particularly in eudicots:

  • Core duplication event: A core eudicot-wide gene duplication event gave rise to two distinct lineages: FAD2-α and FAD2-β . This duplication event provided the foundation for subsequent functional diversification.

  • Neofunctionalization: Independent neofunctionalization events in both FAD2-α and FAD2-β lineages have resulted in functionally diverse FAD2-LIKE enzymes involved in unusual fatty acid biosynthesis . These divergent forms can catalyze hydroxylation, conjugation, acetylenation, and epoxygenation reactions beyond the canonical desaturation function.

  • Lineage-specific expansions: The FAD2-α lineage has expanded extensively in Asterales and Apiales (two main clades of campanulids) through ancient gene duplications . These expansions correlate with the emergence of specialized metabolic pathways.

  • Positive selection: Positive selection has been detected in both Asterales and Apiales lineages, potentially enabling the evolution of specialized fatty acid metabolism in these groups .

  • Seed-specific vs. constitutive FAD2: Seed-type FAD2 genes evolved independently after segregation by duplication from constitutively expressed FAD2 genes .

For phylogenetic analyses of FAD2, researchers should consider these complex evolutionary patterns and use appropriate models that account for variable rates of molecular evolution across lineages.

What are the optimal methods for cloning and expressing functional recombinant FAD2 proteins?

Successful cloning and expression of functional FAD2 requires careful consideration of several factors:

  • Source material selection:

    • For developmental studies, collect tissues at different growth stages, particularly mid-maturation seeds which typically show higher FAD2 expression

    • Consider temperature conditioning of source plants (lower temperatures often increase FAD2 expression)

  • Cloning strategies:

    • RT-PCR is effective for isolating FAD2 transcripts, as demonstrated in studies with Brassica juncea

    • Include the complete coding sequence with appropriate flanking regions for optimal expression

    • Consider codon optimization when expressing in heterologous systems

  • Expression systems:

    • Yeast (Saccharomyces cerevisiae or Rhodotorula glutinis) provides a eukaryotic environment with appropriate ER structure

    • Nicotiana benthamiana transient expression is effective for rapid functional analysis

    • Bacterial expression often requires membrane fraction isolation and special solubilization techniques

  • Functional verification methods:

    • Complementation of FAD2 mutations in Arabidopsis

    • Direct measurement of fatty acid profiles using GC-MS

    • Heterologous expression in yeast followed by fatty acid analysis

When expressing recombinant FAD2, researchers must ensure proper membrane insertion and appropriate cofactor availability (Fe, cytochrome b5, NADH) for full enzymatic activity.

How can researchers effectively analyze FAD2 enzyme activity and substrate specificity?

Comprehensive analysis of FAD2 activity requires multiple complementary approaches:

  • In vivo functional assays:

    • Heterologous expression in yeast followed by fatty acid profile analysis is the most common approach

    • Complementation assays in FAD2-deficient Arabidopsis mutants with phenotypic evaluation

    • Transient expression in plant systems like Nicotiana benthamiana

  • In vitro enzymatic assays:

    • Microsomal fraction isolation from expressing cells

    • Incubation with radiolabeled substrate (typically [14C]oleic acid)

    • Analysis of products using thin-layer chromatography or HPLC

  • Substrate specificity determination:

    • Supply various fatty acid substrates to determine conversion efficiency

    • For novel FAD2-LIKEs, test a range of substrates beyond oleic acid

    • Quantify product formation using GC-MS or LC-MS/MS techniques

  • Kinetic parameter analysis:

    • Determine Km and Vmax values using varying substrate concentrations

    • Compare parameters across different FAD2 variants and homologs

When analyzing enzyme activity, researchers should account for the membrane-bound nature of FAD2 and ensure appropriate electron transport components are available for optimal activity.

What approaches are most effective for generating and characterizing FAD2 mutants in Arabidopsis?

Several complementary approaches can be employed for FAD2 mutant generation and characterization:

  • Mutant generation strategies:

    • CRISPR/Cas9 gene editing for precise mutations

    • T-DNA insertion collections (available through ABRC and NASC)

    • EMS mutagenesis followed by TILLING for point mutations

    • RNAi or antisense approaches for partial knockdowns

  • Phenotypic characterization:

    • Fatty acid profiling using GC-MS (expect increased oleic acid, decreased linoleic acid)

    • Growth phenotyping at different temperatures (fad2 mutants often show temperature-sensitive phenotypes)

    • Membrane fluidity assessments using fluorescence polarization techniques

    • Stress tolerance tests (particularly cold and salt stress)

  • Molecular characterization:

    • Transcriptome analysis to identify affected pathways

    • Lipidomics to assess membrane lipid composition changes

    • Protein-protein interaction studies to identify partners

  • Physiological assessments:

    • Measure germination rates and hypocotyl elongation (can be affected by FAD2 mutation)

    • Assess responses to hormonal treatments (particularly jasmonic acid and salicylic acid pathways)

    • Evaluate pathogen response (FAD2 mutation can affect defense pathways)

Researchers should note that fad2 mutants in Arabidopsis have shown dwarf phenotypes at 22°C, indicating that changes in membrane lipid composition significantly impact plant development .

How is FAD2 gene expression regulated by environmental factors in different plant species?

FAD2 expression is highly responsive to environmental cues, with significant variation across species and tissues:

  • Temperature regulation:

    • Cold stress typically increases FAD2 expression to enhance membrane fluidity through increased unsaturated fatty acids

    • In Arabidopsis, cold stress affects transcription of FAD2 isogenes differently, with differential regulation of FAD2.1 and FAD2.2

    • In cotton, enhanced FAD2 expression occurs under cold stress conditions

    • In Brassica juncea, one-fold higher expression at lower temperatures and three-fold lower expression at higher temperatures has been observed

  • Light effects:

    • Light acts as an effective regulator of FAD2 expression in many plant species

    • Photoperiod changes can alter the balance of FAD2 isoform expression

  • Wounding response:

    • Mechanical wounding effectively regulates FAD2 expression

    • This response often coordinates with jasmonic acid signaling pathways

  • Tissue-specific regulation:

    • FAD2 genes show distinct expression patterns in different tissues

    • Seed-specific FAD2 isoforms are primarily expressed during seed development

    • Constitutive FAD2 isoforms maintain baseline membrane fatty acid composition in vegetative tissues

In experimental designs, researchers should account for these environmental factors when studying FAD2 expression, potentially using controlled environment chambers to manipulate temperature, light cycles, and other variables systematically.

What are the key differences between seed-specific and constitutively expressed FAD2 isoforms?

FAD2 isoforms exhibit distinct characteristics based on their expression patterns:

CharacteristicSeed-Specific FAD2 (FAD2-1)Constitutive FAD2 (FAD2-2/3/4)
Expression timingHighly expressed during seed development, particularly mid-maturation Expressed throughout plant development in various tissues
Evolutionary originEvolved independently after duplication from constitutive FAD2 genes Represent the ancestral expression pattern
Response to temperatureOften less responsive to temperature changesMore responsive to environmental temperature fluctuations
Biological rolePrimary role in determining seed oil fatty acid compositionMaintenance of membrane fluidity in vegetative tissues
RegulationOften regulated by seed-specific transcription factorsResponsive to broader environmental and developmental cues
Substrate specificityGenerally more specific to seed storage lipidsMay have broader substrate range for membrane lipids

These differences emerged through subfunctionalization and neofunctionalization following gene duplication events in the FAD2 lineage. When conducting expression studies, researchers should select appropriate tissue types and developmental stages based on which FAD2 isoform is being investigated, and use isoform-specific primers for accurate quantification.

How do post-transcriptional and post-translational mechanisms contribute to FAD2 regulation?

Beyond transcriptional control, FAD2 is regulated through multiple levels of post-transcriptional and post-translational mechanisms:

  • mRNA stability regulation:

    • Temperature can affect FAD2 mRNA stability, with lower temperatures often increasing transcript half-life

    • Specific RNA-binding proteins may regulate FAD2 transcript stability in response to environmental cues

  • Alternative splicing:

    • Some FAD2 genes undergo alternative splicing that can affect protein function

    • Splicing patterns may change in response to stress conditions

  • Protein stability and turnover:

    • FAD2 protein levels are regulated through controlled degradation

    • Ubiquitin-proteasome pathway likely plays a role in FAD2 turnover under changing conditions

  • Post-translational modifications:

    • Phosphorylation may regulate FAD2 activity in response to signaling pathways

    • Other potential modifications include redox regulation through cysteine residues

  • Protein-protein interactions:

    • Interaction with cytochrome b5 is essential for electron transfer and enzyme activity

    • Association with other membrane proteins may regulate localization and function

While transcriptional studies are more common, researchers investigating FAD2 regulation should consider these post-transcriptional and post-translational mechanisms, particularly when transcriptional changes don't fully explain observed fatty acid profile alterations. Techniques such as pulse-chase experiments, co-immunoprecipitation, and phosphoproteomic analyses can provide insights into these regulatory mechanisms.

How does FAD2 activity contribute to cold stress tolerance in plants?

FAD2 plays a crucial role in plant adaptation to cold temperatures through several mechanisms:

  • Membrane fluidity modulation:

    • FAD2 increases membrane fluidity by converting monounsaturated (oleic acid) to polyunsaturated (linoleic acid) fatty acids

    • This adjustment is critical as plants need to maintain membrane fluidity at lower temperatures

    • The skill of adjusting membrane fluidity by varying the unsaturated fatty acid contents is characteristic of cold-responsive plants

  • Gene expression changes:

    • Cold stress induces FAD2 expression in various plants, including Arabidopsis and cotton

    • In cotton, cold stress enhances the transcription of FAD2 isogenes (FAD2-3 and FAD2-4)

    • In olive, cold stress increases FAD2.2 expression while reducing FAD2.1 expression

  • Coordination with other desaturases:

    • FAD2 works in concert with other desaturases like FAD7 and FAD8

    • While FAD7 and FAD8 are specifically induced under low-temperature conditions, other desaturases generally are not

  • Physiological impacts:

    • Plants with higher FAD2 activity show improved cold tolerance

    • Conversely, fad2 mutants typically exhibit increased cold sensitivity

    • The increase in dienoic fatty acids through FAD2 activity directly correlates with improved cold stress resistance

For experimental assessment of FAD2's role in cold tolerance, researchers should combine gene expression analysis, membrane fluidity measurements, and physiological stress tests at various temperatures, comparing wild-type plants with FAD2 overexpression and knockout lines.

What physiological and developmental phenotypes are associated with FAD2 mutations or altered expression?

FAD2 mutations or expression changes result in diverse phenotypic effects beyond simple changes in fatty acid profiles:

  • Growth and morphology alterations:

    • FAD2 overexpression modifies multiple physiological features in transgenic seedlings, including seed germination rates and hypocotyl elongation

    • FAD2 mutants in Arabidopsis form dwarf phenotypes at 22°C compared to wild-type plants

    • Brassica napus fad2 mutants show variable phenotypes in leaf epidermal structure and permeability

  • Hormone signaling impacts:

    • Changes in polyunsaturated fatty acid (PUFA) content due to FAD2 mutation affect development through multiple hormone pathways:

      • Salicylic acid (SA) pathway

      • Jasmonic acid (JA) pathway

      • Abscisic acid (ABA) pathway

    • FAD2 mutations can induce JA-responsive genes, affecting pathogen resistance

  • Metabolic pathway alterations:

    • Cytochrome c oxidase expression is inhibited in both wild-type and fad2 mutant Arabidopsis cells at low temperatures

    • Treatment with JA and ABA causes major changes in extracellular phospholipids in FAD2-modified plants

  • Reproductive development effects:

    • Seed viability and germination rates can be affected

    • Pollen development may be impaired in plants with severely reduced FAD2 function

When studying FAD2-modified plants, researchers should conduct comprehensive phenotypic analyses across different developmental stages and environmental conditions to fully capture the range of effects, as these may not be apparent under standard growth conditions.

How does FAD2 function interact with other stress response pathways in plants?

FAD2 function is integrated with multiple stress response networks, creating complex interactions:

  • Cross-talk with oxidative stress responses:

    • FAD2 activity can influence reactive oxygen species (ROS) levels

    • Lipid peroxidation products derived from polyunsaturated fatty acids act as signaling molecules

    • These signals can induce antioxidant defense systems

  • Integration with temperature sensing:

    • FAD2-mediated changes in membrane fluidity may directly affect membrane-bound temperature sensors

    • The physical state of membranes influences calcium channel activity and other signaling components

  • Coordination with drought and salt stress responses:

    • FAD2 activity leads to increased dienoic fatty acid content, which enhances resistance to both cold and salt stress

    • Altered membrane composition affects water permeability and ion transport

  • Interaction with pathogen defense pathways:

    • FAD2-derived lipid changes affect JA biosynthesis and signaling

    • JA is a key hormone in plant defense against necrotrophic pathogens

    • FAD2 mutation can affect resistance to pathogens like Botrytis cinerea

  • Regulation of programmed cell death:

    • Fatty acid desaturation status influences susceptibility to programmed cell death

    • This affects hypersensitive response during pathogen attack

For comprehensive studies of these interactions, researchers should employ systems biology approaches, including transcriptomics, metabolomics, and network analysis, ideally comparing wild-type plants with FAD2-modified lines under multiple stress conditions simultaneously.

What strategies can be employed for metabolic engineering of FAD2 to optimize plant oil composition?

Several sophisticated approaches can be applied for FAD2 engineering to modify plant oil composition:

  • Gene silencing technologies:

    • RNA interference (RNAi) targeting specific FAD2 isoforms

    • CRISPR/Cas9-mediated gene editing for precise modifications

    • Artificial microRNAs for tissue-specific suppression

    • Antisense expression for partial FAD2 suppression

  • Promoter engineering:

    • Substitution of native promoters with seed-specific promoters for targeted expression

    • Use of inducible promoters for controlled temporal expression

    • Engineering of promoter elements to alter temperature responsiveness

  • Protein engineering approaches:

    • Site-directed mutagenesis of catalytic residues to alter activity

    • Domain swapping between FAD2 variants to create chimeric enzymes with novel properties

    • Directed evolution to generate FAD2 variants with enhanced stability or altered substrate preference

  • Multi-gene strategies:

    • Combinatorial engineering of FAD2 with other fatty acid modifying enzymes

    • Introduction of heterologous FAD2-LIKEs from other species with unusual fatty acid synthesis capabilities

    • Concurrent modification of transcription factors regulating FAD2 expression

These approaches should focus on improving oil stability for high oleic acid varieties while maintaining appropriate membrane lipid composition in vegetative tissues to avoid negative impacts on plant growth and stress tolerance .

How can evolutionary analysis of FAD2 inform the discovery of novel enzyme functions for biotechnology?

Evolutionary analysis provides powerful insights for enzyme discovery and engineering:

  • Identification of functionally divergent FAD2-LIKEs:

    • Accelerated rates of molecular evolution in certain FAD2 lineages can indicate neofunctionalization

    • Branches showing positive selection are prime candidates for novel catalytic functions

    • Systematic screening of uncharacterized FAD2s from these lineages may yield enzymes with valuable biotechnological properties

  • Reconstruction of ancestral sequences:

    • Ancestral sequence reconstruction can reveal evolutionary transitions in function

    • Synthesis and characterization of ancestral FAD2 enzymes may uncover properties lost in modern enzymes

  • Correlation of sequence features with function:

    • Comparative analysis of FAD2 enzymes with known functions can identify signature residues for specific activities

    • These signatures can guide targeted mutagenesis to engineer desired functions

  • Exploration of lineage-specific expansions:

    • The extensive expansion of FAD2-α in Asterales and Apiales suggests specialized functions

    • These plant families may contain FAD2 variants involved in the synthesis of rare fatty acids

  • Integration with metabolite profiling:

    • Correlation of FAD2 phylogeny with unusual fatty acid profiles across species

    • Species with unique fatty acid compositions are likely to contain FAD2 variants with novel functions

Researchers applying these evolutionary approaches should combine phylogenetic analysis with functional testing, potentially using high-throughput screening systems to assess activity on diverse substrates.

What methodological approaches can resolve contradictory data regarding FAD2 function and regulation?

Researchers frequently encounter seemingly contradictory results regarding FAD2 function. The following methodological approaches can help resolve these discrepancies:

  • Standardized experimental conditions:

    • Precisely control temperature, light, and growth stage when comparing FAD2 expression across studies

    • Document growth conditions in detail to allow proper comparison between studies

    • Create standard protocols for FAD2 activity assays to enable direct comparison of results

  • Isoform-specific analysis:

    • Design primers and antibodies specific to individual FAD2 isoforms

    • Analyze expression patterns of specific isoforms rather than total FAD2 activity

    • Separate the functions of seed-specific vs. constitutive FAD2 genes

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and lipidomics data

    • This integration can reveal post-transcriptional and post-translational regulation

    • Network analysis may identify regulatory factors causing divergent responses

  • Genetic background consideration:

    • Account for genetic background effects in mutant studies

    • Use multiple independent mutant alleles or transformants

    • Perform complementation studies to confirm phenotype-genotype relationships

  • Tissue-specific and subcellular analysis:

    • Employ cell type-specific promoters for targeted expression

    • Use fluorescent protein fusions to track subcellular localization

    • Apply laser-capture microdissection for tissue-specific analysis

When confronted with contradictory data, researchers should systematically identify variables that differ between studies (species, tissues, environmental conditions, genetic backgrounds) and design experiments that specifically address these variables while maintaining consistent methodology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.