Recombinant Arabidopsis thaliana Outer envelope pore protein 16-2, chloroplastic (OEP162)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Outer Envelope Pore Protein 16-2, Chloroplastic (OEP162)

Recombinant Arabidopsis thaliana Outer envelope pore protein 16-2, chloroplastic (OEP162) is a protein that functions as a voltage-dependent, high-conductance channel . It is found in the outer envelope of chloroplasts in Arabidopsis thaliana, a model organism widely used in plant biology research .

Function and Characteristics

OEP162 belongs to the OEP16 family of proteins, which are known to form pores in the outer envelope of chloroplasts, facilitating the transport of various molecules across the membrane .

Key features of OEP162:

  • Location: Chloroplast outer envelope

  • Function: Voltage-dependent, high-conductance channel

  • Family: OEP16 family of proteins

Role in Plant Biology

Arabidopsis thaliana is a valuable model organism for plant research because many of its genes have orthologs in humans . Studying OEP162 in Arabidopsis can provide insights into basic cellular functions and evolutionary relationships . Research on Arabidopsis thaliana has broad implications for plant biology, including advancements in agriculture, horticulture, and understanding epigenetic regulation in development and environmental responses .

OEP16 Family and Chloroplast Function

OEP16 proteins are crucial for the proper functioning of chloroplasts, which are essential organelles responsible for photosynthesis in plant cells. These proteins facilitate the transport of metabolites and ions necessary for photosynthesis and other chloroplast functions.

Arabidopsis thaliana as a Model Organism

Arabidopsis thaliana serves as a key model system in biology, with many discoveries directly relevant to human health and disease being elaborated through its study . The completion of the Arabidopsis thaliana genome sequence in 2000 revealed that a majority of human genes known to play a role in disease have orthologs in Arabidopsis .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify this in your order; we will prioritize its development.
Synonyms
OEP162; At4g16160; dl4120w; FCAALL.207; Outer envelope pore protein 16-2, chloroplastic; Chloroplastic outer envelope pore protein of 16 kDa 2; AtOEP16-2; OEP16-2; Outer plastid envelope protein 16-S; AtOEP16-S; Seeds outer plastid envelope protein 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OEP162
Target Protein Sequence
MEKSGGRIVMDEIRSFEKAHLFDLGHPLLNRIADSFVKAAGVGALQAVSREAYFTVVDGA GFDSNNVGPPSEITGNKKHRFPNLRGESSKSLDALVKNTGKESLQWGLAAGLYSGITYGM TEVRGGAHDWRNSAVAGALTGAAMAMTTSERTSHEQVVQSALTGAAISTAANLLSSVF
Uniprot No.

Target Background

Function

Voltage-dependent, high-conductance channel exhibiting slight cation selectivity. It displays selectivity for amino acids but excludes triosephosphates and uncharged sugars. This protein functions as a non-essential amino acid-selective channel and translocation pore for NADPH:protochlorophyllide oxidoreductase A (PORA) and possibly PORB.

Gene References Into Functions
  1. The OEP16.2 isoform influences metabolic fluxes during ABA-controlled seed development and germination. PMID: 22155670
  2. OEP16-S, containing multiple G-box ABA-responsive elements (ABREs) in its promoter region, is regulated by ABI3 and ABI5. It shows strong expression during seed maturation and in pollen grains. PMID: 16709189
Database Links

KEGG: ath:AT4G16160

STRING: 3702.AT4G16160.2

UniGene: At.33105

Protein Families
Tim17/Tim22/Tim23 family, Plastid outer envelope porin OEP16 (TC 1.B.30) subfamily
Subcellular Location
Plastid, chloroplast outer membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in pollen and seeds. Present in leaves and cotyledons.

Q&A

What is the function of OEP162 in Arabidopsis thaliana?

OEP162 (also known as OEP16.2) is a channel protein located in the outer envelope membrane of plastids in Arabidopsis thaliana. The primary biological function of OEP162 is to facilitate transport of amino acids across the plastid outer envelope. Unlike OEP16.1, which is prominent in early embryo development and first leaves of the growing plantlet, OEP16.2 dominates in late seed development stages associated with dormancy and desiccation, as well as early germination events. Research has shown that OEP16.2 expression in seeds is under control of the phytohormone abscisic acid (ABA), and loss of OEP16 causes metabolic imbalance, particularly of amino acids during seed development and early germination .

How does OEP162 differ structurally from other outer envelope proteins?

OEP162 belongs to the OEP16 family, which consists of proteins with four membrane-spanning α-helices. This α-helical structure is in contrast to other known OEPs, which form β-barrel pores in the plastid outer envelope membrane similar to porin-like channels from the outer membrane of Gram-negative bacteria. The OEP16 family belongs to the PRAT (pre-protein and amino acid transporter) superfamily, characterized by a four α-helical secondary structure, the presence of a TIM17 domain, and the absence of a classical chloroplast transit peptide .

What is the expression pattern of OEP162 during plant development?

OEP162 shows a distinct expression pattern that alternates with OEP16.1 during plant development. While OEP16.1 is predominantly expressed in early embryo development and first leaves of the growing plantlet, OEP162 dominates in late seed development stages associated with dormancy and desiccation, as well as early germination events. This alternating expression pattern has been confirmed at both transcript and protein levels in both Arabidopsis thaliana and Pisum sativum (pea). RNA of OEP16.2 shows strong and exclusive localization in seed, embryo, cotyledon, and pollen tissues .

What are the recommended storage conditions for recombinant OEP162 protein?

For recombinant Arabidopsis thaliana OEP162, optimal storage conditions are:

  • Short-term storage: Store at -20°C

  • Extended storage: Conserve at -20°C or -80°C

  • Working aliquots: Store at 4°C for up to one week

Repeated freezing and thawing is not recommended as it can compromise protein integrity. The shelf life varies based on storage conditions:

  • Liquid form: Approximately 6 months at -20°C/-80°C

  • Lyophilized form: Up to 12 months at -20°C/-80°C

How can OEP162 be isolated and purified for experimental studies?

Isolation of OEP162 can be performed using the following methodological approach:

  • cDNA Isolation:

    • Design degenerated oligonucleotide primers directed toward conserved regions of known plant OEP16.2 isoforms

    • Use SMART RACE cDNA Amplification Kit in combination with gene-specific primers to isolate overlapping N- and C-terminal fragments

    • Generate full-length cDNA in a single PCR step using primers flanking the 5' and 3' ends of the predicted open reading frame

  • Protein Expression:

    • Express recombinant protein in an in vitro E. coli expression system

    • Add N-terminal tag (e.g., 10xHis-tag) to facilitate purification

    • Express the full-length protein (amino acids 1-178)

  • Purification:

    • Use affinity chromatography with Ni-NTA resin for His-tagged proteins

    • Perform size exclusion chromatography to improve purity

    • Confirm identity using Western blot analysis with anti-OEP16 antibodies

What techniques are effective for studying OEP162 membrane localization?

To study the membrane localization of OEP162, researchers can employ several complementary techniques:

  • Plastid Fractionation Studies:

    • Isolate plastids from plant tissue using differential centrifugation

    • Separate outer envelope, inner envelope, and thylakoid membrane fractions

    • Analyze protein distribution using Western blot with anti-OEP16 antibodies

    • Test resistance against salt extraction and thermolysin treatment to confirm integral membrane protein characteristics

  • Fluorescent Protein Fusion Assays:

    • Generate chimeric DNA encoding fusions of OEP162 with fluorescent proteins (e.g., GFP)

    • Transform plants with the fusion constructs

    • Visualize localization using confocal microscopy

  • Immunoelectron Microscopy:

    • Fix plant tissue samples and prepare ultrathin sections

    • Label with anti-OEP16 antibodies followed by gold-conjugated secondary antibodies

    • Visualize using transmission electron microscopy to determine precise membrane localization

How does OEP162 interact with abscisic acid (ABA) signaling pathways during seed development?

OEP162 expression in seeds is under control of the phytohormone abscisic acid (ABA), leading to an ABA-hypersensitive phenotype of germinating oep16 knockout mutants. The OEP16.2 promoter contains four ABREs (ABA-responsive elements), which respond to ABA signals during seed development .

To investigate this interaction experimentally:

  • Promoter Activity Analysis:

    • Use promoter-GUS fusion constructs to monitor OEP16.2 promoter activity in response to ABA treatment

    • Quantify expression levels using qRT-PCR in wild-type and ABA signaling mutants

  • Phenotypic Analysis of Knockout Mutants:

    • Compare germination rates and ABA sensitivity between wild-type, single knockout (oep16.2), and triple knockout (oep16.1/2/4) plants

    • Measure germination rates under varying ABA concentrations (0-10 μM)

  • Metabolite Profiling:

    • Analyze amino acid and metabolite profiles in wild-type and mutant seeds during development and germination

    • Use targeted LC-MS/MS to quantify specific metabolites affected by ABA treatment in relation to OEP162 function

What is the molecular mechanism by which OEP162 transports amino acids across the plastid envelope?

The molecular mechanism of amino acid transport by OEP162 involves:

  • Channel Formation and Selectivity:

    • OEP162 forms a selective channel pore with an estimated diameter of approximately 0.8-1 nm

    • The S-domain (a peptide loop connecting the first and second membrane-spanning helices) likely functions as the selectivity filter

    • Channel selectivity can be studied using:

      • Liposome swelling assays with different amino acids and metabolites

      • Electrophysiological measurements in reconstituted black lipid bilayers

  • Oligomeric Structure:

    • OEP16 proteins likely function as homo-oligomers

    • The functional state can be determined using:

      • Chemical crosslinking experiments

      • Blue-native PAGE to analyze oligomeric states

      • Single-particle cryo-EM for structural determination

  • Transport Kinetics:

    • Measure transport rates using radioisotope-labeled amino acids

    • Determine substrate specificity by comparing transport rates of different amino acids

    • Identify key residues involved in substrate binding through site-directed mutagenesis

How can researchers address the functional redundancy between OEP16 isoforms in experimental designs?

When studying OEP16 isoforms, researchers must account for potential functional redundancy through careful experimental design:

  • Generation of Multiple Mutant Lines:

    • Create single (oep16.1, oep16.2, oep16.4), double (oep16.1/2, oep16.1/4, oep16.2/4), and triple (oep16.1/2/4) knockout mutants

    • Verify knockout status using PCR genotyping and protein expression analysis

    • Include appropriate wild-type lines (OEP16.1/2/4-WT) as controls

  • Tissue-Specific and Developmental Stage Analysis:

    • Design experiments that target specific developmental stages where one isoform predominates

    • For OEP162 studies, focus on late seed development and early germination

    • For OEP16.1 studies, focus on early embryo development and leaf tissues

  • Complementation Studies:

    • Transform mutant lines with constructs expressing individual OEP16 isoforms

    • Use isoform-specific promoters to maintain natural expression patterns

    • Compare phenotypic rescue to determine functional equivalence or specificity

  • Isoform-Specific Protein Interaction Studies:

    • Perform co-immunoprecipitation with isoform-specific antibodies

    • Use yeast two-hybrid or split-GFP assays to identify unique interaction partners

    • Map interaction domains through deletion analysis and site-directed mutagenesis

How should researchers interpret contradictory findings regarding OEP162 function?

When faced with contradictory findings regarding OEP162 function, researchers should:

What statistical approaches are most appropriate for analyzing metabolomic data in OEP16 mutant studies?

When analyzing metabolomic data from OEP16 mutant studies, the following statistical approaches are recommended:

  • Multivariate Analysis:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Partial Least Squares Discriminant Analysis (PLS-DA) to distinguish between experimental groups

    • Hierarchical Cluster Analysis (HCA) to identify metabolite patterns

  • Univariate Analysis:

    • ANOVA with appropriate post-hoc tests for comparing multiple genotypes

    • Use false discovery rate (FDR) correction for multiple comparisons

    • Consider mixed-effects models when analyzing time-series data during development

  • Pathway Enrichment Analysis:

    • Map affected metabolites to biochemical pathways

    • Calculate pathway enrichment scores to identify significantly impacted metabolic processes

    • Integrate with transcriptomic data when available to build a systems-level understanding

How can researchers differentiate between direct and indirect effects of OEP162 on plant metabolism?

To differentiate between direct and indirect effects of OEP162 on metabolism:

  • Time-Course Experiments:

    • Monitor metabolic changes at multiple time points after inducible expression or inhibition

    • Primary (direct) effects typically occur rapidly, while secondary effects emerge later

    • Use time-resolved metabolomics to establish cause-and-effect relationships

  • In Vitro Transport Assays:

    • Reconstitute purified OEP162 in liposomes

    • Test direct transport of various metabolites

    • Compare transport capabilities with metabolic phenotypes observed in vivo

  • Conditional Mutants and Tissue-Specific Expression:

    • Use inducible or tissue-specific promoters to control OEP162 expression

    • Examine local versus systemic metabolic effects

    • Create a spatiotemporal map of metabolic changes following OEP162 manipulation

FeatureOEP16.1OEP16.2OEP16.4
Predominant expression tissueEarly embryo development, first leavesLate seed development, early germinationUbiquitous at lower levels
Response to ABALimitedStrong inductionNot well characterized
Knockout phenotypeAffects PORA import, photoprotectionABA-hypersensitive germinationSubtle when alone
Proposed primary functionPORA import, amino acid transportSeed amino acid transportComplementary function
Promoter elementsStandard plastid protein elementsContains four ABREsLimited characterization

What emerging technologies could advance our understanding of OEP162 structure-function relationships?

Several emerging technologies hold promise for advancing our understanding of OEP162:

  • Cryo-Electron Microscopy:

    • Determine high-resolution structure of OEP162 in different functional states

    • Visualize substrate binding sites and conformational changes

    • Map the topology of membrane insertion and oligomerization

  • CRISPR-Cas9 Base Editing:

    • Generate precise amino acid substitutions without disrupting the entire gene

    • Create allelic series to map functionally important residues

    • Introduce fluorescent or affinity tags at endogenous loci

  • Single-Molecule Techniques:

    • Apply patch-clamp to study channel properties at the single-molecule level

    • Use single-molecule FRET to monitor conformational changes during transport

    • Perform single-particle tracking to analyze dynamic behavior in native membranes

How might comparative analysis of OEP16 proteins across plant species inform evolutionary adaptation of plastid function?

Comparative analysis of OEP16 proteins can reveal evolutionary patterns through:

  • Phylogenetic Analysis:

    • Compare OEP16 sequences across diverse plant lineages

    • Identify conserved domains versus species-specific adaptations

    • Trace the evolutionary history of gene duplication events that generated the OEP16 family

  • Functional Complementation Studies:

    • Test if OEP16 proteins from different species can functionally substitute for Arabidopsis OEP162

    • Identify critical residues that underlie species-specific functional differences

    • Correlate molecular differences with physiological adaptations

  • Ecological and Environmental Correlation:

    • Compare OEP16 sequence and expression across plants from different habitats

    • Analyze adaptations in species with specialized seed dormancy or germination requirements

    • Test hypotheses about how OEP16 variants contribute to environmental adaptation

What potential applications exist for engineered OEP162 variants in plant biotechnology?

Engineered OEP162 variants could have several biotechnological applications:

  • Improved Seed Quality Traits:

    • Engineer OEP162 to modulate amino acid transport and composition in seeds

    • Enhance protein content or essential amino acid profile in crop seeds

    • Optimize seed storage compound accumulation for improved nutritional value

  • Stress Tolerance Engineering:

    • Modify OEP162 expression or regulation to enhance ABA-mediated stress responses

    • Engineer germination timing to avoid adverse environmental conditions

    • Improve seedling establishment under abiotic stress conditions

  • Metabolic Engineering Platforms:

    • Use engineered OEP162 variants to control plastid-cytosol metabolite exchange

    • Create controlled compartmentalization of engineered metabolic pathways

    • Enhance flux of precursors or products between cellular compartments in biotechnology applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.