Recombinant Arabidopsis thaliana Outer envelope pore protein 16-3, chloroplastic/mitochondrial (OEP163)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OEP163; B14.7; At2g42210; T24P15.12; Outer envelope pore protein 16-3, chloroplastic/mitochondrial; Chloroplastic outer envelope pore protein of 16 kDa 3; AtOEP16-3; OEP16-3; Mitochondrial complex I subunit B14.7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OEP163
Target Protein Sequence
MDPAEMRYLEEEDGPLMKTIKGSITGFGAGTIYGTILATWKDVPRVERNVALPGLIRTLK MMGTHGLTFAAIGGVYIGVEQLVQNFRSKRDFYNGAIGGFVAGASVLGYRARSIPTAIAA GATLAVTSALIDSGGQTTRVDNGREYYPYTVEKRAEADS
Uniprot No.

Target Background

Function
Voltage-dependent, high-conductance channel exhibiting slight cation selectivity; preferentially conducts amino acids but excludes triosephosphates and uncharged sugars. It functions as a non-essential amino acid-selective channel protein and translocation pore for NADPH:protochlorophyllide oxidoreductase A (PORA) and possibly PORB.
Gene References Into Functions
  1. B14.7 and Tim23-2 are components of respiratory chain complex I. PMID: 22730406
Database Links

KEGG: ath:AT2G42210

STRING: 3702.AT2G42210.2

UniGene: At.12442

Protein Families
Tim17/Tim22/Tim23 family, Plastid outer envelope porin OEP16 (TC 1.B.30) subfamily
Subcellular Location
Plastid, chloroplast outer membrane; Multi-pass membrane protein. Mitochondrion outer membrane; Multi-pass membrane protein. Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is OEP163 and what is its role in plant cells?

OEP163 (Outer Envelope Pore protein 16-3) is a membrane protein located in the outer envelope of chloroplasts and mitochondria in Arabidopsis thaliana. It functions as a voltage-dependent high-conductance channel with slight cation selectivity, specifically allowing the passage of amino acids while excluding triosephosphates and uncharged sugars . OEP163 belongs to the OEP16 family, which is part of the PRAT (pre-protein and amino acid transporter) superfamily . These proteins play crucial roles in metabolite transport across organelle membranes, particularly affecting amino acid fluxes during seed development and germination .

How does OEP163 differ from other members of the OEP16 family?

While all OEP16 family members share structural similarities as membrane channel proteins, they have distinct expression patterns and potentially different substrate specificities:

  • OEP16.1 is prominently expressed in early embryo development and first leaves of growing plantlets, and has been specifically implicated in the import of NADPH:protochlorophyllide oxidoreductase A (PORA)

  • OEP16.2 is dominant in late seed development stages associated with dormancy and desiccation, as well as early germination events, and its expression is regulated by abscisic acid (ABA)

  • OEP163 (also known as OEP16.3) has been less extensively characterized but interacts with mitochondrial proteins according to STRING protein interaction analysis, suggesting potential roles in mitochondrial processes

The OEP16.2 proteins in angiosperms have gained an additional exon in the loop sequence connecting the first and second membrane-spanning helices (the S-domain), which may function as a selectivity filter, potentially giving OEP16.2 a slightly different substrate specificity compared to OEP16.1 .

What are the recommended methods for recombinant expression of OEP163?

For successful recombinant expression of OEP163 and other OEP16 family proteins, the following method has been established:

  • Expression system: E. coli has been successfully used for overexpression of OEP16 proteins

  • Isolation strategy: OEP16 proteins typically form inclusion bodies in E. coli, which can be isolated and purified in an unfolded state

  • Purification method: Ion exchange chromatography in buffer containing 6 M urea has been effective for purifying the unfolded protein

  • Protein refolding: Properly folded OEP16 can be obtained by diluting the protein-containing urea buffer 1:10 with a buffer containing 20 mM HEPES/KOH pH 7.6, 1 mM EDTA, and 0.03% octaethyleneglycol-monododecylether (C12E8)

  • Protein concentration: Final protein concentrations of 0.1-0.3 mg/ml have been recommended for subsequent analyses

For isotope-enriched protein required for NMR studies, recombinant expression in minimal media with isotope sources is necessary, followed by similar purification and reconstitution in detergent micelles .

What are the challenges in purifying functional OEP163 and how can they be overcome?

Purification of functional membrane proteins like OEP163 presents several challenges:

  • Protein aggregation: OEP16 proteins tend to form inclusion bodies when overexpressed, requiring denaturation and careful refolding procedures. Use of 6 M urea for solubilization followed by controlled dilution into detergent-containing buffer has been successful

  • Maintaining native structure: Critical detergent concentration must be maintained above the critical micellation concentration (CMC) to provide a suitable hydrophobic environment. For C12E8, concentrations above 0.006% are necessary

  • Verification of proper folding: Stopped-flow fluorescence and CD measurements can be used to monitor protein folding. Properly folded wild-type OEP16 exhibits stronger tryptophan fluorescence with a maximum at 336 nm (compared to 355 nm in the unfolded state)

  • Oligomerization state: OEP16 proteins may undergo oligomerization as part of their functional state, which should be verified using methods such as dynamic light scattering

What techniques are most effective for studying the structure of OEP163?

Multiple complementary techniques have proven effective for structural characterization of OEP16 family proteins:

  • Fluorescence spectroscopy: Using the intrinsic tryptophan fluorescence to assess tertiary structure and folding kinetics. Excitation at 295 nm wavelength is recommended to exclude tyrosine fluorescence

  • Circular dichroism (CD) spectroscopy: Valuable for assessing secondary structure content, particularly α-helical content through measurement at 228 nm wavelength

  • NMR spectroscopy: High-resolution NMR has been used to assign 99% of the amide backbone and provide detailed secondary structure of OEP16 on a per-residue basis using software like TALOS+

  • Stopped-flow measurements: Useful for studying folding kinetics with either fluorescence or CD detection

  • Dynamic light scattering (DLS): Helps determine the size distribution of proteins in solution and can provide information about oligomerization state

  • High-pressure liquid chromatography (HPLC): Used for pre-characterization of purified protein samples

What is known about the folding kinetics of OEP16 proteins and how does this inform handling of OEP163?

The folding of OEP16 proteins occurs through multiple phases and is highly dependent on detergent concentration:

  • Three-step folding model: Complete folding involves: (a) initial formation of helices, (b) insertion of helices into the hydrophobic environment of detergent micelles, and (c) rearrangement of loops and helices (potentially including oligomerization)

  • Detergent concentration effects: Folding reactions are pseudofirst-order with respect to detergent concentration. Below the critical micellation concentration (CMC) of C12E8 (0.006%), folding cannot be observed

  • Kinetic parameters: At 0.03% C12E8 concentration, folding exhibits rate constants of approximately k2 = 427 ± 30 s−1 and k3 = 29.0 ± 2.2 s−1 for the second and third phases as measured by fluorescence detection (see Table 1)

Table 1: Folding Rate Constants of OEP16 Proteins

Proteink2 (s−1)k3 (s−1)
With fluorescence detection
Wild-type427 ± 3029.0 ± 2.2
W100F (Trp-77)255 ± 57
W77F (Trp-100)377 ± 1358.0 ± 5.8
With CD detection
Wild-type269 ± 5912.8 ± 1.9

When handling OEP163, researchers should consider these kinetic properties to ensure proper folding, particularly maintaining sufficient detergent concentration and allowing adequate time for the complete folding process before functional studies .

What methods are used to study the amino acid transport function of OEP163?

Several approaches have been employed to characterize the transport function of OEP16 family proteins, which can be applied to OEP163:

  • Electrophysiological measurements: Using artificial lipid bilayers to measure channel conductivity and substrate selectivity

  • Radioactive transport assays: Utilizing radioactively labeled amino acids to measure transport rates across reconstituted proteoliposomes

  • NMR titration studies: These have successfully located residues important for amino acid binding and provided information on transmembrane helix packing

  • Genetic complementation: Using OEP16-deficient mutants complemented with functional OEP16 cDNA to verify in vivo function and substrate specificity

  • Metabolite profiling: Analyzing changes in metabolite content, particularly amino acids, in tissues of knockout mutants compared to wild-type plants

How do mutations in OEP16 family genes affect plant phenotypes?

Studies of OEP16 knockout mutants have revealed several phenotypic effects, providing insights into their functional roles:

  • Metabolic imbalance: Loss of OEP16 causes metabolic imbalance, particularly affecting amino acid content during seed development and early germination

  • Abscisic acid (ABA) sensitivity: OEP16.2 expression is under control of the phytohormone ABA, leading to an ABA-hypersensitive phenotype in germinating knockout mutants

  • Conflicting phenotypes: For OEP16.1, different mutant lines from the same seed stock (SALK_024018) have shown contradictory phenotypes:

    • Some mutants exhibit defects in import of PORA (NADPH:protochlorophyllide oxidoreductase A), aberrant etioplast structures, and cell death upon illumination

    • Others show normal PORA import and greening

  • Genetic background effects: Additional T-DNA insertions and point mutations in the original seed stocks can affect the establishment of cell death phenotypes, highlighting the importance of proper genetic characterization

How can site-directed mutagenesis of OEP163 inform our understanding of its structure-function relationship?

Site-directed mutagenesis studies of OEP16 family proteins have provided valuable insights into structure-function relationships:

  • Tryptophan mutants: Single-tryptophan mutants (W100F and W77F) have been used to study folding kinetics. W100F lacks the slowest relaxation phase of the folding process, indicating Trp-100 can be used as an indicator for the rate-limiting second folding event

  • S-domain modification: The S-domain (loop connecting the first and second membrane-spanning helices) functions as a potential selectivity filter. Mutations in this region could help define substrate specificity differences between OEP16 family members

  • Conserved residues: Targeting evolutionarily conserved amino acids for mutation can identify residues critical for channel function, substrate binding, or structural integrity

  • Chimeric proteins: Creating chimeras between different OEP16 isoforms can help identify regions responsible for differential expression patterns or substrate specificities

What insights can proteomics and interactomics provide about OEP163 function?

Proteomics and interactomics approaches offer advanced insights into OEP163 function within cellular networks:

  • Protein interaction partners: STRING database analysis suggests OEP163 interacts with several mitochondrial proteins, including components of the NADH dehydrogenase complex and mitochondrial import machinery (TIM9)

  • Post-translational modifications: iPTMnet database contains information on OEP163 (UniProt AC: O48528), suggesting potential regulation through post-translational modifications

  • Co-expression networks: OEP163 shows high co-expression correlation (0.981) with 2Fe-2S ferredoxin-like superfamily proteins and other mitochondrial components, suggesting functional relationships

  • Comparative interactomes: Comparing interaction networks between OEP16 family members could reveal isoform-specific functions and regulatory pathways

Table 2: Top OEP163 Protein Interaction Partners According to STRING Database

ProteinDescriptionScore
Q8VZ65_ARATHUncharacterized protein At1g677850.981
F21O3.192Fe-2S ferredoxin-like superfamily protein0.981
FRO1NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial0.977
TIM9Mitochondrial import inner membrane translocase subunit TIM90.973
Dl4250WNADH-ubiquinone oxidoreductase0.972

How should researchers design experiments to distinguish between the roles of OEP163 versus other OEP16 family members?

When investigating OEP163-specific functions, consider these experimental design approaches:

  • Tissue- and development-specific expression analysis: Use RT-PCR, RNA-seq, or promoter-GUS fusion analysis to map expression patterns across tissues and developmental stages for all OEP16 family members

  • Isoform-specific antibodies: Develop antibodies targeting unique regions of each OEP16 isoform to track protein localization and abundance

  • Multiple knockout lines: Generate and analyze single, double, and triple knockout mutants to identify redundant versus specific functions, similar to the OEP16 triple mutant approach (oep16.1/2/4)

  • Complementation specificity: Test whether OEP163 can functionally complement other OEP16 knockout phenotypes, and vice versa

  • Substrate specificity assays: Compare amino acid selectivity profiles between reconstituted OEP16 isoforms using electrophysiological measurements or transport assays

What are the critical controls when studying recombinant OEP163 in different experimental systems?

When working with recombinant OEP163, the following controls are essential:

  • Folding verification: Confirm proper protein folding using spectroscopic methods (fluorescence, CD) by comparing spectra with previously characterized OEP16 proteins

  • Detergent effects: Include detergent-only controls in all functional assays as detergents can affect membrane permeability independently of inserted proteins

  • Membrane integration: Verify proper membrane insertion orientation when reconstituting in liposomes or expression in heterologous systems

  • Multiple expression systems: Compare protein functionality when expressed in different systems (E. coli, yeast, insect cells) to rule out host-specific artifacts

  • Genetic background verification: When using T-DNA insertion mutants, rigorously verify the absence of additional insertions or mutations through whole-genome sequencing or backcrossing, as demonstrated by the contradictory phenotypes observed in different OEP16.1 mutant lines

How do researchers explain the conflicting observations regarding OEP16.1 function in PORA import?

The contradictory findings regarding OEP16.1 function in PORA import highlight important research considerations:

  • Genetic background effects: Re-screening of the original SALK_024018 seed stock revealed multiple T-DNA insertions and additional mutations that affect phenotypes

  • Redundancy mechanisms: Alternative import pathways may compensate for the loss of OEP16.1 in some genetic backgrounds

  • Experimental conditions: Differences in growth conditions, light intensity, and developmental timing can influence the manifestation of phenotypes

  • Resolution approach: Samol et al. (2011) isolated pure lines of four OEP16-deficient mutants with different cell death properties and showed that one mutant (Atoep16-1;6) imported PORA by a pathway that did not permit PORA to attain a functional state for photoprotection

  • Definitive evidence: Genetic complementation with OEP16-1 cDNA or a GFP::OEP16-1 fusion restored normal greening in the Atoep16-1;6 mutant, confirming the functional role of OEP16-1 in pPORA import

What methodological approaches can resolve contradictions in membrane protein research?

To address contradictions in membrane protein research, particularly with OEP163 and related proteins:

  • Multiple methodological approaches: Combine genetic, biochemical, structural, and computational methods to build a consistent model of protein function

  • Independent genetic tools: Use multiple knockout/knockdown technologies (T-DNA insertion, CRISPR-Cas9, RNAi) to confirm phenotypes

  • Precise genetic characterization: Thoroughly analyze mutant lines for additional mutations or insertions through whole-genome sequencing or detailed Southern blot analysis

  • Developmental timecourse studies: Analyze phenotypes and protein function across multiple developmental stages and environmental conditions

  • Quantitative phenotyping: Use quantitative measurements (e.g., metabolite levels, fluorescence parameters) rather than qualitative observations to enable statistical analysis of subtle phenotypes

What are the promising approaches for determining the three-dimensional structure of OEP163?

Future structural studies of OEP163 could benefit from these approaches:

  • Advanced NMR techniques: Building on existing NMR studies that have assigned 99% of the amide backbone, additional experiments could define side-chain positions and intermolecular interactions

  • Cryo-electron microscopy: Recent advances in cryo-EM for membrane proteins could allow visualization of OEP163 in near-native conditions, potentially revealing oligomeric structures

  • X-ray crystallography of stabilized constructs: Engineering stabilized versions through limited mutagenesis or fusion with crystallization chaperones could facilitate crystal formation

  • Integrative structural biology: Combining data from multiple experimental sources (NMR, cross-linking mass spectrometry, SAXS) with computational modeling to develop comprehensive structural models

  • In situ structural studies: Techniques like in-cell NMR or proximity labeling could provide insights into structural arrangements in the native membrane environment

How might systems biology approaches enhance our understanding of OEP163 function in plant metabolism?

Systems biology approaches offer powerful frameworks to contextualize OEP163 function:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from OEP163 mutants to build network models of altered metabolic fluxes

  • Flux analysis: Using isotope labeling to track metabolite movement and transformation in wild-type versus oep163 mutant plants

  • Condition-specific interactomes: Mapping protein-protein interactions under different developmental stages or stress conditions to understand dynamic roles of OEP163

  • Comparative genomics: Analyzing evolutionary conservation and divergence of OEP16 family members across plant species to identify core versus specialized functions

  • Mathematical modeling: Developing computational models of chloroplast-cytosol-mitochondria metabolite exchange to predict the consequences of altered OEP163 function on whole-cell metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.