Recombinant Arabidopsis thaliana Outer envelope protein 64, chloroplastic (OEP64)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
OEP64; TOC64-III; At3g17970; MEB5.19; Outer envelope protein 64, chloroplastic; Translocon at the outer membrane of chloroplasts 64-III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-589
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OEP64
Target Protein Sequence
MASQAANLWVLLGLGLAGILMLTKKLKKTVREDFGAFIDKLMLLPPPQPAPPKAPHPLTG LTFAVSDVFDITGYVTGFGHPDWVRTHEAASSTSPVVSTLVEGGATCVGKTVVDEFAFSI SGENKHYDSPTNPAAPTRIPGGACSGAAVAVATNAVDFALGIDTVGGVRVPAGYCGVLGF KSSYGAISNTGIIPVSSSLDSVGWFARDPNTLRRVGHVLLQLPFATQRNPRQIILADDCF QLLKIPVDRITQVVTKSAEKLFGRQLLKHQNLETYFETKVPSLKEFARTKAIANTKVSTS RLLANVMQLLQRHEFLQNHGDWINTVKPAIDPVILSQVCENPELTNEETENLNAIRNETR VAIGSLLKDDGILVIPTLPAVPPKLGSKEITSEDYQNRASSLLSIASISGCCQVTVPLGH HEKCPISVSFIGRHGGDRFLLDTVQTMYPSLQEYSSIVTDPKSSKKAITKEESAEIAKEK GNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKK NVKAYLRRGTAREMLGDCKGAIEDFRYALVLEPNNKRASLSAERLRKFQ
Uniprot No.

Target Background

Function
This chaperone receptor mediates Hsp90-dependent protein targeting to chloroplasts. It functions as a bifunctional preprotein receptor, acting on both sides of the membrane. It is not essential for efficient pre-protein import into plastids.
Gene References Into Functions
  1. Our research indicates that the TPR domain of AtToc64 exhibits higher affinity towards the C-terminal residues of Hsp70. PMID: 24700626
  2. This study elucidates the mechanism of recognition of Hsp70 and Hsp90 chaperone C-termini by the Tetratricopeptide Repeat (TPR) domain of the chloroplast import receptor Toc64. PMID: 24391770
  3. Toc64 participates in chloroplast protein import, cooperating in part with Toc33. PMID: 23131143
  4. Toc64 is involved in preprotein translocation across the outer envelope membrane at both membrane sites. PMID: 17306301
  5. This work constructed homology models of the 3-TPR domain of chloroplastic Toc64 from various species. PMID: 19198901
Database Links

KEGG: ath:AT3G17970

STRING: 3702.AT3G17970.1

UniGene: At.8043

Subcellular Location
Plastid, chloroplast outer membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, cotyledons, leaves and flower buds.

Q&A

Basic Research Questions

  • What is the function of OEP64/Toc64 in Arabidopsis thaliana chloroplasts?

  • How many homologs of OEP64/Toc64 exist in Arabidopsis thaliana and where are they localized?

In Arabidopsis, three paralogous genes encode Toc64-related proteins:

  • atTOC64-III (located in chloroplasts)

  • atTOC64-V (located in mitochondria)

  • atTOC64-I (located in the cytosol)

These distinct subcellular localizations have been confirmed through multiple approaches including fluorescence microscopy with GFP fusion proteins, immunoblotting with compartment-specific antibodies, and proteomics studies. This tri-organellar distribution suggests specialized functions for each homolog, potentially in coordinating protein targeting across different cellular compartments .

  • What experimental approaches are recommended for studying OEP64/Toc64 function in plants?

Several complementary approaches have proven effective:

  • Genetic knockout/knockdown studies: T-DNA insertion mutants for individual Toc64 homologs and crossing to generate double and triple mutants

  • Protoplast transformation: For transient expression studies and import assays

  • Chloroplast isolation: For in vitro protein import experiments using radiolabeled precursor proteins

  • Artificial microRNA (amiRNA): The newly developed outer envelope-specific amiRNAs (oemiRs) technique allows simultaneous downregulation of multiple loci

  • Phenotypic analysis: Including chlorophyll accumulation measurements, photosynthetic performance (PAM fluorometry), and stress response tests

  • Transcript and protein level analysis: RT-PCR and immunoblotting to monitor expression changes in mutant backgrounds

This multi-faceted approach helps overcome functional redundancy issues that have complicated the characterization of this protein family.

Advanced Research Questions

  • How do findings on OEP64/Toc64 function differ between studies, and what methodological differences might explain these contradictions?

Significant contradictions exist in the literature regarding OEP64/Toc64 function:

StudyKey FindingsMethodological Approach
Aronsson et al. (2007) No detectable phenotype in single, double or triple toc64 mutants; no impact on protein import efficiencyT-DNA insertion mutants; standard growth conditions; in vitro import assays
Sommer et al. (2013) Light intensity-dependent growth phenotype in toc64-III mutants; reduced import of pOE33 and pSSU precursorsT-DNA insertion mutants; varied light conditions; protoplast-based import assays

These contradictions may stem from:

  • Different experimental conditions, particularly light intensity during growth

  • Varying sensitivity of detection methods for import efficiency

  • Different genetic backgrounds of the mutant lines

  • Alternative import pathways that may compensate differently depending on conditions

  • What is the relationship between OEP64/Toc64 and other components of the TOC complex, and how can researchers investigate these interactions?

OEP64/Toc64 appears to functionally interact with other TOC components, particularly:

  • Toc33 (also called TOC34 homolog): A ppi1 (deficient in TOC33) and toc64-III double mutant shows significant transcriptional changes in HSP90 and TOC75-III, suggesting functional interdependence

  • Toc75-III: Protein levels of this core channel component are reduced in the ppi1/toc64-III double mutant, indicating that Toc64-III and Toc33 may cooperate in Toc75-III insertion or stabilization

To investigate these interactions, researchers should consider:

  • Co-immunoprecipitation assays to detect physical interactions

  • Blue native PAGE to analyze intact TOC complexes

  • In vitro reconstitution of import components

  • FRET or BiFC assays for in vivo interaction studies

  • Quantitative proteomics to monitor changes in TOC complex composition in various mutant backgrounds

  • Epistasis analysis through systematic generation of higher-order mutants

  • How does OEP64/Toc64 function under different stress conditions, and what methodological approaches reveal these stress-specific roles?

Research indicates that OEP64/Toc64 function may be particularly relevant under stress conditions:

  • Cold stress: The oemiR approach identified cold-sensitive mutants including those targeting TOC159, which is functionally related to OEP64/Toc64

  • Light intensity variation: toc64-III mutants show a light intensity-dependent growth phenotype

Recommended methods for investigating stress-specific roles include:

  • Growth assays under controlled stress conditions (cold, high light, drought)

  • Chlorophyll fluorescence measurements (Fv/Fm) before and after stress exposure

  • Import assays using isolated chloroplasts from plants grown under stress conditions

  • Time-course transcriptomics and proteomics after stress exposure

  • Comparison with other stress-responsive outer envelope proteins like OEP40 and SFR2

The newly developed oemiR approach is particularly valuable as it allows screening for multiple stress conditions simultaneously and can overcome functional redundancy issues .

  • How is protein import efficiency best quantified in toc64 mutant studies, and what controls are critical?

Reliable quantification of import efficiency requires careful experimental design:

Recommended methodology:

  • Isolation of intact chloroplasts from wild-type and mutant plants

  • Preparation of radiolabeled (35S-methionine) or fluorescently labeled precursor proteins

  • Time-course import assays (typically 0-30 minutes)

  • Quantification by phosphorimaging or fluorescence detection

  • Protease treatment to distinguish bound from imported proteins

  • Fractionation to confirm localization to correct compartment

Critical controls:

  • Multiple independent precursor proteins (e.g., pOE33, pSSU)

  • ATP-depleted samples as negative controls

  • Competition assays with unlabeled precursors

  • Internal standard protein for normalization

  • Chloroplast integrity checks (e.g., oxygen evolution measurements)

  • Both in vitro (isolated chloroplasts) and in vivo (protoplast) assays

A multi-method approach combining both chloroplast and protoplast-based assays provides the most robust assessment of protein import efficiency .

Methodological Questions

  • What are the recommended approaches for generating and characterizing recombinant Arabidopsis thaliana OEP64 protein for in vitro studies?

For successful recombinant OEP64 production:

Expression systems:

  • E. coli: BL21(DE3) strain with pET vectors for high yield

  • Cell-free expression systems for potentially problematic membrane proteins

  • Wheat germ extract systems for plant-compatible post-translational modifications

Purification strategy:

  • Affinity tags: N-terminal His6 or GST tags with TEV cleavage site

  • Solubilization with mild detergents (DDM, LDAO, or Triton X-100)

  • Sequential chromatography: IMAC followed by size exclusion

  • Quality control via SDS-PAGE, western blotting, and mass spectrometry

Functional characterization:

  • Reconstitution into liposomes for transport/channel studies

  • Circular dichroism to assess secondary structure integrity

  • Surface plasmon resonance for interaction studies with HSP90 and other chaperones

  • GTPase activity assays if studying interactions with the TOC GTPases

For membrane proteins like OEP64, maintaining native folding is critical; therefore, detergent screening and optimization of expression conditions (temperature, induction time) are essential steps .

  • How can artificial microRNAs be effectively designed and utilized to study OEP64/Toc64 function in Arabidopsis?

The recently developed outer envelope-specific artificial microRNAs (oemiRs) offer a powerful approach:

Design principles:

  • Identify conserved regions across homologs for simultaneous silencing

  • Use algorithms like WMD3 (Web MicroRNA Designer) for optimal target sites

  • Ensure specificity by BLAST search against the Arabidopsis genome

  • Design microRNAs following established criteria (21 nucleotides with specific mismatches at positions 1 and 21)

Vector construction:

  • Use pGreen-based binary vectors with highly specific promoters

  • Include appropriate selection markers (e.g., hygromycin resistance)

  • Consider inducible promoters for temporal control

Plant transformation and screening:

  • Agrobacterium-mediated floral dip transformation

  • Select transformants using appropriate antibiotics

  • Confirm microRNA expression by RT-qPCR

  • Verify target gene knockdown by RT-qPCR and western blotting

  • Screen for phenotypes under various conditions

The oemiR approach has been successfully used to generate a collection targeting all verified outer envelope proteins, allowing systematic screening for specific phenotypes like cold sensitivity .

  • What strategies can effectively address functional redundancy when studying the TOC64 gene family?

Functional redundancy has complicated the characterization of TOC64 proteins. These approaches can overcome this challenge:

Genetic approaches:

  • Generate higher-order mutants (double and triple knockouts)

  • Use artificial microRNAs targeting conserved regions of multiple homologs simultaneously

  • Create chimeric proteins to test domain-specific functions

  • Employ CRISPR/Cas9 for precise genome editing of multiple targets

Biochemical approaches:

  • Comparative analysis of protein-protein interactions for each homolog

  • Substrate specificity assays to identify homolog-specific preferences

  • Organelle-specific functional complementation

Environmental manipulation:

  • Test function under various stress conditions that may reveal homolog-specific roles

  • Examine developmental stage-specific functions throughout the plant life cycle

Systems biology:

  • Transcriptomics and proteomics in single and multiple mutant backgrounds

  • Metabolic profiling to identify subtle phenotypes

  • Flux analysis of protein import in different cellular compartments

Research has demonstrated that comprehensive analysis under various stress conditions (particularly cold stress and high light) can reveal phenotypes not apparent under standard growth conditions .

  • How can researchers effectively analyze the structural features of OEP64/Toc64 to understand its function at the chloroplast outer envelope?

Structural analysis approaches:

  • Homology modeling based on related proteins with known structures

  • Secondary structure prediction algorithms (focus on TPR domains)

  • Molecular dynamics simulations of membrane insertion

  • Mutation of key residues followed by functional assays

  • Cross-linking studies to identify interaction interfaces

OEP64/Toc64 contains distinctive domains:

  • N-terminal transmembrane domain for membrane anchoring

  • Central region with amidase signature-like domains

  • C-terminal tetratricopeptide repeat (TPR) domain for protein-protein interactions, particularly with HSP90

Understanding these domains helps predict:

  • Topology in the membrane (using protease protection assays)

  • Interaction partners (especially chaperones like HSP90)

  • Evolution in relation to other protein translocases

Structural comparison with other outer envelope proteins can provide insights into common mechanisms of integration and stability in the lipid bilayer .

  • What experimental approaches can determine if OEP64/Toc64 has additional functions beyond protein import in Arabidopsis thaliana?

Multiple lines of evidence suggest OEP64/Toc64 may have roles beyond protein import:

Recommended experimental approaches:

  • Interactome analysis: Proximity labeling (BioID or APEX) to identify the full range of interaction partners

  • Metabolomics: Untargeted profiling to identify metabolic alterations in toc64 mutants

  • Developmental studies: Detailed phenotyping across various developmental stages

  • Stress response assays: Test responses to multiple abiotic and biotic stresses

  • Organelle crosstalk analysis: Investigate impacts on mitochondria-chloroplast communication

Potential alternative functions to investigate::

  • Signal transduction at the chloroplast surface

  • Lipid trafficking between organelles

  • Retrograde signaling (chloroplast to nucleus)

  • Coordination of dual-targeted proteins

  • Involvement in organelle dynamics or division

Evidence from toc64-III mutants showing light intensity-dependent phenotypes suggests potential roles in light signaling or adaptation pathways independent of bulk protein import .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.