Recombinant Arabidopsis thaliana Outer envelope protein 64, mitochondrial (OM64)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Arabidopsis thaliana Outer envelope protein 64, mitochondrial (OM64), also referred to as mtOM64, is a protein found in the outer membrane of mitochondria in Arabidopsis thaliana . It is a paralog of the chloroplast outer envelope protein import receptor At TOC64-III (translocase of the outer chloroplast envelope) . Sequence analysis reveals that mtOM64 contains three C-terminal tetratricopeptide repeat (TPR) motifs, similar to the C-terminal TPR domains of At TOC64-III and TOM70, which function to recognize chloroplast and mitochondrial proteins bound to HSP90 . OM64 acts as a chaperone receptor, mediating Hsp90-dependent protein targeting to mitochondria .

Role in Protein Import

Research indicates that mtOM64 plays a role in mitochondrial protein import . While it shares sequence similarity with At TOC64-III, a chloroplast protein import receptor, mtOM64 is localized to the mitochondrial outer membrane . Studies involving Arabidopsis lines with T-DNA insertions in the mtOM64 coding region have been conducted to investigate its function .

In vitro protein import assays using mitochondria from these knockout plants showed that the import of F Ad was consistently reduced by 30-40% in plants lacking mtOM64, while the import of AOX, PiC, GR, and TOM40 remained unaffected compared to wild-type mitochondria . This suggests that mtOM64 is involved in the import of a specific subset of precursor proteins .

Role in Senescence

Characterization of the $$ \beta $$-barrel protein, OM47, identifies its role in leaf senescence by mediating the transport of chloroplast breakdown products across the outer mitochondrial membrane for recycling . Mutation of OM47 in Arabidopsis thaliana by T-DNA insertion had no effect on the import of proteins, such as the $$ \beta $$-barrel proteins translocase of the outer membrane 40 (TOM40) or sorting and assembly machinery 50 (SAM50), into mitochondria .

Expression Analysis

Transcript expression analysis of OM47 showed relatively low abundance throughout most developmental stages but was slightly higher during the early stages of germination and throughout leaf senescence . In om47-1 and om47-2 lines, a clear increase in transcript abundance of OM47 was observed after 3 weeks, with a 2- to 4-fold higher expression compared to the wild type .

Compensation Mechanism

A developmental compensation mechanism increases the abundance of OM47 protein from 10–15% of the wild type in mitochondria isolated from 2- to 4-week-old om47 mutants to wild-type levels at 8 weeks . This recovery is achieved by an up-regulation of OM47 transcript abundance in the mutants .

Mutant Analysis

Two independent T-DNA insertion lines for OM47 (At3g27930) were characterized . PCR screening and genomic DNA sequencing of these lines revealed that both om47-1 and om47-2 have inserts within the intron regions . Immunodetection on total mitochondrial protein isolated from 3-week-old wild-type (Col-0) and om47 mutant plants revealed an ~90% decrease in OM47 protein abundance in the two T-DNA lines, showing that the T-DNA inserts in the introns effectively reduced the amount of the OM47 protein .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OM64; TOC64-V; At5g09420; T5E8.220; Outer envelope protein 64, mitochondrial; Mitochondrial outer membrane protein 64; mtOM64; Translocon at the outer membrane of chloroplasts 64-V; AtTOC64-V
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-603
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
OM64
Target Protein Sequence
MSNTLSLIQSNASNPKVWVVIGVTVAGIVILAETRKRRIRALREEDFGAFLDRFELLPFP PPPPPAAKQSLSGLTFSISDAFDVKDYITGFGCPQWKKTHEAAEKTAVVVTTLLKNGATC VGKTIMDELGFGIIGENKHYGTPINPLMPDNVPGGCSSGSAVSVGAELVDFSLGIDTTGG VRVPAAFCGILGFRPSQGTVSSVGVLPNSQSLETVGWFASDPSVLCQVGHALLNLSAVTH RRQRSLIFADDLFELSDIPKQKSVQVVRKAIENLSGYKTPKHVNVGQYVASNVPSLAEFC EQSGKSQNSASTLRALSSVMLAIQRHEFKTNHEEWWQTCKSFLGPRFSNDVVTALKSKNE SIKSLYRVKNEMRATIQSLLKEDGILVIPTVADPPPRLNTKRNKSLNEFLDRTYALSCIA SMSGCCQVTIPLGEHGDRPISVSLLTYYGGDKFLLDTTLDVYASLQDQAKLASNLAPVSD TNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAFLELCCFQQ AEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEAAADFRHALVLEPQNKTAKVAEKRLR KHI
Uniprot No.

Target Background

Function
Chaperone receptor mediating Hsp90-dependent protein targeting to mitochondria.
Gene References Into Functions
  1. The TPR domain of AtOm64 does not distinguish between the C-termini of Hsp70 and Hsp90. [AtOm64] PMID: 24700626
Database Links

KEGG: ath:AT5G09420

STRING: 3702.AT5G09420.1

UniGene: At.10055

Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in roots and flower buds. Detected in leaves.

Q&A

What is Arabidopsis thaliana Outer envelope protein 64, mitochondrial (OM64)?

OM64 is a mitochondrial outer membrane protein in Arabidopsis thaliana that functions as a receptor in protein import pathways. It is a paralogue of the chloroplast docking protein Toc64 and contains a cytosolic-exposed TPR (tetratricopeptide repeat) domain. This protein is unique to plants and may functionally replace the yeast/mammalian Tom70 receptor protein, which is absent in plant mitochondria. OM64 plays a crucial role in recognizing and binding heat shock proteins (Hsp90 and Hsp70) that guide preproteins to the mitochondrial surface for subsequent import .

How does OM64 differ from its paralogues in Arabidopsis?

In Arabidopsis, three paralogous genes encode Toc64-related proteins with distinct subcellular localizations and functions:

ParalogueGene NameLocalizationFunction
atTOC64-IIIAT3G17970ChloroplastsChloroplast protein import
atTOC64-V (OM64)AT5G09420MitochondriaMitochondrial protein import
atTOC64-IAT1G08980CytosolLess characterized

While these proteins share sequence similarity, they have evolved specialized functions in different cellular compartments. The chloroplastic Toc64-III and mitochondrial OM64 both contain TPR domains that interact with heat shock proteins, but they function in different organellar protein import systems .

What are the alternative names and identifiers for OM64?

OM64 is referenced by several names in scientific literature and databases:

  • Mitochondrial outer membrane protein 64 (mtOM64)

  • Translocon at the outer membrane of chloroplasts 64-V (TOC64-V)

  • AtTOC64-V

  • Gene identifiers: At5g09420, T5E8.220, T5E8_220

These alternative designations reflect both its localization to the mitochondrial outer membrane and its evolutionary relationship to the chloroplastic Toc64 proteins .

What role does the TPR domain play in OM64 function?

The TPR (tetratricopeptide repeat) domain of OM64 is critical for its function in protein import pathways. This domain:

  • Forms a binding pocket that specifically recognizes and binds to the conserved C-terminal (M)EEVD motif of heat shock proteins Hsp90 and Hsp70

  • Serves as a docking platform for chaperone-preprotein complexes at the mitochondrial surface

  • Contains key phosphorylation sites that regulate its binding affinity to chaperones

  • Facilitates the transfer of preproteins from cytosolic chaperones to the mitochondrial translocation machinery

  • Provides specificity in the recognition of import-competent preproteins

The crystal structure of the OM64 TPR domain (PDB: 6HPG) reveals the structural basis for these interactions and regulatory mechanisms .

How does phosphorylation affect OM64 function?

Phosphorylation serves as a key regulatory mechanism for OM64 function:

  • Reduced Binding Affinity: Phosphorylation within the TPR domain significantly reduces the binding affinity of OM64 to Hsp90, as demonstrated through isothermal titration calorimetry experiments

  • Impaired Protein Import: In vivo expression studies with different OM64 variants showed that phosphorylation impairs the import efficiency of mitochondrial preproteins, specifically the pFAD subunit of mitochondrial ATP synthase

  • Regulatory Mechanism: This post-translational modification provides a mechanism for fine-tuning mitochondrial protein import in response to cellular conditions

  • Dynamic Regulation: The phosphorylation state of OM64 can be modulated in response to various physiological conditions, allowing for adaptive control of mitochondrial protein import

These findings highlight phosphorylation as an important molecular switch that regulates the function of this receptor protein in the mitochondrial import pathway .

What is the functional relationship between plant OM64 and yeast/mammalian Tom70?

Although not homologous proteins, OM64 in plants appears to functionally replace Tom70, which is present in yeast and mammalian mitochondria but absent in plants:

FeaturePlant OM64Yeast/Mammalian Tom70
LocalizationMitochondrial outer membraneMitochondrial outer membrane
Domain structureContains TPR domainContains TPR-like repeats
Chaperone interactionBinds Hsp90/Hsp70 via TPR domainBinds Hsp90/Hsp70
Preprotein recognitionIndirect via chaperonesIndirect via chaperones
RegulationPhosphorylation of TPR domainDifferent regulatory mechanisms

Despite different evolutionary origins, both proteins serve as receptors for chaperone-preprotein complexes at the mitochondrial surface, highlighting a case of convergent evolution in organellar protein import systems .

What methods are used to study OM64 phosphorylation?

Researchers employ several complementary approaches to study OM64 phosphorylation:

  • Mass Spectrometry:

    • Phosphopeptide enrichment coupled with LC-MS/MS for identification of specific phosphorylation sites

    • Quantitative phosphoproteomics to measure changes in phosphorylation levels under different conditions

  • Site-directed Mutagenesis:

    • Creation of phosphomimetic mutants (Ser/Thr → Asp/Glu) to simulate constitutive phosphorylation

    • Generation of phosphonull mutants (Ser/Thr → Ala) to prevent phosphorylation

  • Isothermal Titration Calorimetry (ITC):

    • Direct measurement of binding affinities between phosphorylated/non-phosphorylated OM64 and Hsp90

    • Determination of thermodynamic parameters (ΔH, ΔS, ΔG) of the interaction

  • In vivo Expression Studies:

    • Expression of wild-type and phospho-variant OM64 in plants

    • Assessment of mitochondrial protein import efficiency using specific preprotein substrates

These approaches collectively provide insights into the sites, dynamics, and functional consequences of OM64 phosphorylation, as demonstrated in studies showing that phosphorylation reduces Hsp90 binding and impairs import of certain preproteins .

How is recombinant OM64 produced for in vitro studies?

Production of recombinant OM64 typically follows this methodological workflow:

  • Expression System Selection:

    • E. coli is most commonly used for OM64 expression, as indicated in commercial product descriptions

    • Alternative systems include yeast, baculovirus, or mammalian cell expression when specific post-translational modifications are required

  • Construct Design:

    • Cloning of full-length OM64 or specific domains (particularly the TPR domain)

    • Addition of affinity tags (His, GST) for purification

    • Codon optimization for improved expression

  • Expression Optimization:

    • Fine-tuning of induction conditions (temperature, inducer concentration, time)

    • Selection of appropriate E. coli strains (BL21, Rosetta for rare codons)

    • Co-expression with chaperones if solubility issues arise

  • Purification Protocol:

    • Initial capture by affinity chromatography

    • Secondary purification by ion exchange and size exclusion chromatography

    • Quality control by SDS-PAGE, Western blotting, and mass spectrometry

  • Storage:

    • Formulation in buffer containing glycerol as a stabilizer

    • Aliquoting to avoid freeze-thaw cycles

    • Storage at -20°C or -80°C for long-term preservation

What techniques are used to study protein-protein interactions involving OM64?

Several complementary techniques are employed to investigate OM64 interactions:

  • Biophysical Methods:

    • Isothermal Titration Calorimetry (ITC): Provides quantitative measurements of binding affinity, stoichiometry, and thermodynamic parameters of OM64-Hsp90/Hsp70 interactions

    • Surface Plasmon Resonance (SPR): Allows real-time measurement of association and dissociation kinetics

  • Co-immunoprecipitation (Co-IP):

    • Isolation of OM64 complexes from plant mitochondria using specific antibodies

    • Identification of interaction partners by mass spectrometry

  • Pull-down Assays:

    • Immobilization of recombinant OM64 on a solid support

    • Incubation with potential binding partners (e.g., Hsp90, Hsp70)

    • Detection of bound proteins by Western blotting

  • Structural Methods:

    • X-ray crystallography: The OM64 TPR domain structure (PDB: 6HPG) provides atomic-level details of the interaction interface

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces

These approaches have been instrumental in characterizing the interactions between OM64 and heat shock proteins, as well as understanding how phosphorylation modulates these interactions .

How do mutations in OM64 affect mitochondrial protein import?

The impact of OM64 mutations on mitochondrial protein import is complex and substrate-dependent:

  • Selective Import Defects:

    • Studies with phosphorylation variants of OM64 show that modifications impair the import efficiency of specific mitochondrial preproteins like pFAD (a subunit of mitochondrial ATP synthase)

    • Not all mitochondrial proteins show equal dependence on OM64 for import

  • Substrate Specificity:

    • Preproteins with high dependence on Hsp90/Hsp70 chaperones are more affected by OM64 mutations

    • The specific properties of transit peptides may determine OM64 dependence

  • Compensatory Mechanisms:

    • Other mitochondrial outer membrane receptors might partially compensate for OM64 dysfunction

    • Alternative import pathways may become more active in OM64 mutants

  • Context-dependent Effects:

    • Import deficiencies might be exacerbated under stress conditions

    • Tissue-specific or developmental effects may occur

These findings suggest that OM64 plays a regulatory role in mitochondrial protein import rather than being absolutely essential for all import pathways, similar to observations with its chloroplastic paralogue Toc64 .

How does phosphorylation of OM64 regulate mitochondrial protein import under stress conditions?

Phosphorylation of OM64 likely serves as a regulatory mechanism to adjust mitochondrial protein import under stress:

  • Stress-Responsive Regulation:

    • Environmental stresses may trigger kinase cascades that alter OM64 phosphorylation status

    • Phosphorylation reduces OM64 binding to Hsp90, potentially downregulating import of specific preproteins

  • Selective Import Regulation:

    • Under stress conditions, phosphorylation may prioritize import of essential proteins while delaying import of others

    • This provides a mechanism to adjust mitochondrial composition in response to changing cellular needs

  • Integration with Cellular Signaling:

    • OM64 phosphorylation may integrate with broader cellular stress response pathways

    • Cross-talk between organellar import machineries (chloroplast and mitochondria) might be coordinated through phosphorylation

  • Temporal Dynamics:

    • The kinetics of OM64 phosphorylation/dephosphorylation may reflect temporal phases of stress response

    • Initial acute response vs. long-term adaptation might involve different phosphorylation patterns

This regulatory mechanism provides flexibility in mitochondrial protein import, allowing the cell to adapt organellar function to changing environmental conditions .

What is the evolutionary significance of OM64 in plant mitochondria?

The evolutionary history of OM64 provides insights into plant-specific adaptations of organellar protein import:

  • Functional Replacement of Tom70:

    • OM64 appears to functionally replace Tom70, which is present in fungi and animals but absent in plants

    • This represents a unique evolutionary adaptation in the plant lineage

  • Relationship to Chloroplast Import Machinery:

    • OM64 is a paralogue of the chloroplastic Toc64, suggesting gene duplication and subsequent functional specialization

    • This paralogy reflects coordination between mitochondrial and chloroplastic protein import systems

  • Plant-specific Adaptations:

    • The presence of OM64 may reflect plant-specific requirements for regulating protein import between mitochondria and chloroplasts

    • The TPR domain-mediated interaction with chaperones represents a conserved mechanism adapted to plant-specific needs

  • Regulatory Mechanisms:

    • The phosphorylation-based regulation of OM64 suggests evolved mechanisms for fine-tuning mitochondrial protein import

    • This may be particularly important in plants, where organellar functions need to adapt to environmental changes and photosynthetic activity

These evolutionary considerations highlight how plant mitochondria have developed unique components and regulatory mechanisms for protein import, distinct from those in other eukaryotic lineages .

How can isothermal titration calorimetry data be analyzed to determine OM64-Hsp90 binding parameters?

Isothermal titration calorimetry (ITC) data analysis for OM64-Hsp90 binding involves several methodological steps:

  • Experimental Design:

    • Protein concentration optimization (typically 5-20 μM OM64 in the cell, 50-200 μM Hsp90 in the syringe)

    • Buffer matching between proteins to minimize dilution heats

    • Temperature selection (typically 25°C for protein interactions)

  • Data Processing:

    • Baseline correction and integration of heat peaks

    • Subtraction of dilution heats (from control experiments)

    • Normalization for protein concentration

  • Binding Model Fitting:

    • Typically, a one-site binding model is used for OM64-Hsp90 interactions

    • Non-linear regression analysis to extract thermodynamic parameters:

      • Association constant (Ka)

      • Enthalpy change (ΔH)

      • Stoichiometry (n)

    • Calculation of derived parameters:

      • Dissociation constant (Kd = 1/Ka)

      • Gibbs free energy (ΔG = -RTlnKa)

      • Entropy change (ΔS = (ΔH-ΔG)/T)

  • Comparative Analysis:

    • Parallel experiments with phosphorylated and non-phosphorylated OM64

    • Statistical assessment of replicate experiments

ParameterNon-phosphorylated OM64Phosphorylated OM64Impact of Phosphorylation
Kd (μM)Lower (higher affinity)Higher (lower affinity)Reduces binding affinity
ΔH (kcal/mol)More negativeLess negativeLess favorable binding enthalpy
ΔS (cal/mol·K)VariableVariableMay affect binding entropy

These analyses have demonstrated that phosphorylation reduces the binding affinity of OM64 to Hsp90, providing a molecular mechanism for regulating mitochondrial protein import .

How can mitochondrial protein import efficiency be measured in wild-type versus OM64 mutant plants?

Several complementary approaches can be used to quantitatively assess protein import efficiency:

  • In vitro Import Assays:

    • Isolation of functional mitochondria from wild-type and om64 mutant plants

    • In vitro translation of radiolabeled preproteins (e.g., pFAD)

    • Incubation of preproteins with isolated mitochondria

    • Analysis of import by SDS-PAGE and autoradiography

    • Quantification of the ratio of mature (processed) to precursor protein

  • In vivo Protein Accumulation:

    • Western blot analysis of steady-state levels of mitochondrial proteins

    • Pulse-chase experiments to determine protein turnover rates

    • Quantification of protein levels normalized to appropriate loading controls

  • Proteomics Approaches:

    • Comparative proteomics of purified mitochondria from wild-type and mutant plants

    • SILAC or TMT labeling for quantitative comparison

    • Bioinformatic analysis of protein abundance changes in specific functional categories

  • Multi-Condition Testing:

    • Comparison under normal growth conditions and various stresses

    • Analysis in different tissues and developmental stages

    • Testing with different classes of preproteins

A comprehensive assessment would combine these approaches to determine which mitochondrial proteins are most affected by OM64 mutation or modification, providing insights into the specificity and regulatory role of this receptor in mitochondrial protein import .

What bioinformatic approaches are most appropriate for analyzing OM64 sequence conservation across plant species?

Analysis of OM64 sequence conservation requires a systematic bioinformatic workflow:

  • Sequence Retrieval:

    • NCBI Protein database and BLAST for initial homolog identification

    • Phytozome for plant-specific genome databases

    • UniProt for curated protein information

  • Multiple Sequence Alignment:

    • MUSCLE or MAFFT for alignment of full-length sequences

    • T-Coffee for accurate alignment of conserved domains

    • Manual refinement focusing on the TPR domain and transmembrane regions

  • Conservation Analysis:

    • ConSurf for mapping conservation onto structural models

    • WebLogo for visualization of sequence conservation patterns

    • Identification of invariant residues in the TPR domain binding pocket

    • Analysis of conservation of phosphorylation sites

  • Structural Integration:

    • Mapping conservation data onto the available OM64 TPR domain structure (PDB: 6HPG)

    • Homology modeling for regions without experimental structures

    • Analysis of conservation in the context of functional sites

  • Evolutionary Analysis:

    • Phylogenetic tree construction to understand evolutionary relationships

    • Assessment of selection pressure using dN/dS ratios

    • Comparison with chloroplast Toc64 paralogues

This comprehensive approach provides insights into evolutionarily conserved features of OM64, highlighting functionally important regions and potential regulatory sites across the plant kingdom .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.