Recombinant Arabidopsis thaliana Outward-rectifying potassium channel 4 (KCO4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time estimates.
Note: All protein shipments are made with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPK4; KCO4; At1g02510; T14P4.16; Two-pore potassium channel 4; AtTPK4; Outward-rectifying potassium channel 4; AtKCO4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
TPK4
Target Protein Sequence
MEEENLLNENLLHPNESSPEETQVTTVSKSKWTILVLAMILLLVYLTFGVCTYSFFRDQF SGTETNLFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVLVSTGVVFLDYLLNRVVSHV LSLQENAILDRINKTRNRAIRDHIAEDGKIRLKWKLCLAFCAVGLCVGSGALFLHVFERL DWLDSVYLSVISVTTVGYGDKTFKTVEGRGFAVFWLLLSTIAMATLFLYLAEMRIDRTTV MKLPPSESEFIVFKLRESGRISEDDIKQIVREFENLEEVPSSGS
Uniprot No.

Target Background

Function
This protein is a voltage-independent, instantaneously activating, potassium-selective plasma membrane ion channel. It functions as an open rectifier, regulated by cytoplasmic pH and extracellular calcium. While exhibiting some permeability to Rb(+) and NH(4)(+), it displays no permeability to Na(+) or Li(+).
Database Links

KEGG: ath:AT1G02510

STRING: 3702.AT1G02510.1

UniGene: At.42597

Protein Families
Two pore domain potassium channel (TC 1.A.1.7) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in pollen.

Q&A

What is the role of outward-rectifying potassium channel 4 (KCO4) in Arabidopsis thaliana?

The outward-rectifying potassium channel 4 (KCO4) in Arabidopsis thaliana belongs to a family of calcium-activated potassium channels that play crucial roles in plant cell signaling and ion homeostasis. Similar to its family member KCO5, KCO4 is involved in potassium efflux from cells, particularly in response to changes in calcium concentrations . These channels contribute to membrane potential regulation, which is essential for various physiological processes including stomatal movement, stress responses, and cellular signaling cascades. KCO4 functions within a complex network of ion channels that collectively determine potassium flux across cellular membranes, affecting numerous aspects of plant development and environmental adaptation.

The evolutionary significance of these channels becomes apparent when considering that Arabidopsis was the first plant to have its entire genome mapped, providing unprecedented insights into the genetic architecture of plant ion channels . Through comprehensive genome analysis, researchers have identified the structural domains of KCO4 that confer its calcium sensitivity and outward-rectifying properties, distinguishing it from other potassium channel types in plants. Understanding KCO4's fundamental role provides a foundation for more specialized research into its specific functions under various conditions.

How does KCO4 differ from other potassium channels in the Arabidopsis genome?

KCO4 is distinguished from other potassium channels in Arabidopsis through several key structural and functional characteristics. Unlike inward-rectifying K+ channels, KCO4 facilitates potassium efflux from cells rather than influx. Compared to its close relative KCO5 (calcium-activated outward-rectifying potassium channel 5), KCO4 exhibits distinct tissue expression patterns and activation properties, though both are calcium-responsive . KCO4 contains specific structural domains that determine its ion selectivity, voltage dependence, and calcium sensitivity.

The Arabidopsis genome mapping project has enabled comparative analysis of the entire potassium channel family, revealing that KCO4 belongs to a specialized subfamily of calcium-activated channels . This comparative genomic approach has elucidated evolutionary relationships between KCO4 and other potassium channels, highlighting conserved regions essential for function as well as unique sequences that confer its specific properties. Functional studies have demonstrated different electrophysiological properties between KCO4 and other channel types, including distinct activation thresholds, ion conductance, and regulatory mechanisms. These differences contribute to the specialized roles KCO4 plays in various cellular contexts and explain why targeted research on this specific channel offers unique insights not obtainable from studying related potassium channels.

What techniques are available for producing recombinant KCO4 protein for research purposes?

Recombinant production of Arabidopsis KCO4 typically employs molecular cloning strategies similar to those used for other plant membrane proteins. The process begins with RNA extraction from Arabidopsis tissues, followed by reverse transcription to obtain cDNA encoding KCO4. Researchers can amplify the KCO4 coding sequence using techniques similar to those employed for other Arabidopsis genes, as demonstrated in research protocols involving related proteins . The amplified sequence is then inserted into an appropriate expression vector containing tags for purification and detection.

Expression systems for recombinant KCO4 production include bacterial systems (E. coli), yeast (Pichia pastoris), insect cell lines, or plant-based expression platforms. Each system offers different advantages for membrane protein expression. For example, researchers working with related plant proteins have successfully used approaches involving guard cell-specific promoters for targeted expression . Purification typically involves membrane solubilization followed by affinity chromatography based on incorporated tags. Critical considerations for successful KCO4 production include optimizing codon usage for the host organism, selecting appropriate detergents for membrane protein solubilization, and developing refolding protocols to ensure functional protein structure. Validation of recombinant KCO4 functionality can be accomplished through electrophysiological techniques like patch-clamp analysis to confirm channel activity and calcium responsiveness.

What are the optimal conditions for functional characterization of recombinant KCO4?

Functional characterization of recombinant KCO4 requires carefully controlled experimental conditions that preserve channel activity while enabling precise measurements. Electrophysiological approaches, particularly patch-clamp techniques, represent the gold standard for functional assessment. The experimental setup should include buffer systems that maintain physiological pH (typically 7.2-7.4) and contain appropriate concentrations of potassium and other ions that mimic cellular conditions. Calcium concentrations must be precisely controlled, as KCO4 is calcium-activated, with experiments typically using a range of calcium concentrations (0-1000 μM) to establish activation thresholds.

Researchers should consider incorporating methodologies similar to those used in studies of related channels, such as the approaches described for analyzing GABA-modulated channels in Arabidopsis . Temperature control is crucial, with most plant channel analyses performed at 20-22°C to reflect typical plant growth conditions. Membrane composition significantly impacts channel function, so reconstitution methods must carefully replicate native lipid environments. Data collection should include current-voltage relationships, calcium dose-response curves, and kinetic parameters of channel opening and closing. Statistical analysis of channel activity should assess single-channel conductance, open probability, and mean open/closed times across multiple experimental replicates. When designing experiments, researchers should also include appropriate controls such as calcium-free conditions and specific channel blockers to confirm that observed currents are indeed mediated by KCO4.

How can I establish Arabidopsis mutant lines to study KCO4 function in planta?

Establishing Arabidopsis mutant lines for KCO4 functional studies requires a systematic approach to genetic modification and phenotypic characterization. Researchers can employ T-DNA insertion lines available from repositories such as the Arabidopsis Biological Resource Centre (ABRC), following protocols similar to those used for obtaining mutant lines of related genes . CRISPR-Cas9 genome editing offers an alternative approach for generating precise mutations in the KCO4 gene. When designing targeting constructs, researchers should carefully consider the gene structure to ensure disruption of functional domains while avoiding unintended effects on neighboring genes, as illustrated by issues encountered with other Arabidopsis mutations .

After obtaining candidate mutant lines, rigorous genotyping is essential to confirm the mutation. This typically involves PCR-based approaches using gene-specific primers and T-DNA border primers, similar to methods described for verifying other Arabidopsis mutants . RT-PCR and qPCR analyses should be performed to confirm the absence or reduction of KCO4 transcript levels in mutant lines. Complementation studies, where the wild-type KCO4 gene is reintroduced into the mutant background, are crucial for confirming that observed phenotypes result from KCO4 disruption rather than background mutations. For tissue-specific studies, researchers can employ promoter-specific complementation approaches, such as the guard cell-specific promoter (GC1) strategy described for MPK12 complementation . Phenotypic characterization should include analyses of growth, development, stress responses, and potassium-dependent processes, with particular attention to systems where potassium flux is known to be important, such as stomatal regulation.

What imaging techniques are most effective for localizing KCO4 in Arabidopsis tissues?

Effective localization of KCO4 in Arabidopsis tissues requires a combination of imaging approaches that provide complementary information about subcellular distribution and tissue-specific expression patterns. Confocal laser scanning microscopy represents the primary technique, offering excellent spatial resolution for visualizing tagged KCO4 proteins. Researchers typically create fluorescent protein fusions (GFP, YFP, or mCherry) with KCO4, using either N- or C-terminal tags depending on protein topology considerations. Expression vectors containing these constructs can be introduced into Arabidopsis through Agrobacterium-mediated transformation, similar to methods described for other proteins in the search results .

For subcellular localization studies, co-localization with established organelle markers is essential. Researchers should include markers for the plasma membrane, tonoplast, and other endomembrane compartments to determine KCO4's precise cellular location. Super-resolution microscopy techniques such as STED (Stimulated Emission Depletion) or PALM (Photo-Activated Localization Microscopy) can provide enhanced resolution beyond the diffraction limit, enabling visualization of channel clusters or microdomains. Immunohistochemistry using KCO4-specific antibodies offers an alternative approach that avoids potential artifacts associated with overexpression of tagged proteins. For tissue-level expression patterns, researchers can generate transgenic plants expressing the β-glucuronidase (GUS) reporter gene under the control of the native KCO4 promoter. This approach enables visualization of promoter activity across different tissues and developmental stages through histochemical staining. Time-lapse imaging can provide valuable insights into dynamic changes in KCO4 localization in response to environmental stimuli or developmental cues.

How does KCO4 function interact with CO₂ signaling pathways in guard cells?

The interaction between KCO4 function and CO₂ signaling in guard cells represents a complex relationship that influences stomatal regulation and plant water use efficiency. While KCO4 has not been directly implicated in CO₂ sensing, it likely participates in the ion homeostasis mechanisms that execute stomatal movements in response to changing CO₂ concentrations. The search results indicate that CO₂ signaling in Arabidopsis guard cells involves a sophisticated pathway including carbonic anhydrases (CA1/CA4) and mitogen-activated protein kinases (particularly MPK12) . These components regulate the activity of OPEN STOMATA 1 (OST1), which subsequently modulates ion channels controlling stomatal aperture.

Potassium channels, including KCO4, function downstream of these signaling components to facilitate the ion fluxes necessary for stomatal closure in response to elevated CO₂. Research on related mutant lines has demonstrated that disruptions in this pathway result in altered CO₂ sensitivity, as observed in the mpk12-3 and ca1/ca4 mutants . A potential experimental approach to investigate KCO4's specific role would involve gas exchange measurements in kco4 mutant lines, analyzing transpiration rates in response to varying CO₂ concentrations (100, 400, and 800 ppm) as performed for other Arabidopsis mutants . Time-resolved CO₂ response curves would be particularly informative, potentially revealing whether KCO4 contributes to the kinetics or magnitude of the stomatal response. Electrophysiological studies of guard cells from kco4 mutants could determine whether outward potassium currents are altered during CO₂-induced stomatal closure, providing direct evidence for KCO4's involvement in this process.

What approaches are recommended for studying KCO4 interaction with calcium signaling networks?

Studying KCO4 interactions with calcium signaling networks requires multidisciplinary approaches that capture both molecular interactions and functional consequences. Since KCO4 is calcium-activated, researchers should begin by precisely characterizing its calcium sensitivity using patch-clamp electrophysiology with defined calcium concentrations to establish activation thresholds and kinetics. Structural studies employing site-directed mutagenesis of predicted calcium-binding domains can identify specific residues essential for calcium sensing, providing insights into activation mechanisms.

To identify calcium signaling components that regulate KCO4, co-immunoprecipitation coupled with mass spectrometry represents a powerful approach for discovering interacting proteins. Yeast two-hybrid or split-ubiquitin assays provide complementary methods for confirming direct protein-protein interactions. Calcium imaging in wild-type versus kco4 mutant plants using genetically encoded calcium indicators (GECIs) like GCaMP can reveal how KCO4 contributes to cellular calcium dynamics. Researchers can adapt approaches similar to those used for studying other calcium-responsive proteins in Arabidopsis, focusing on calcium oscillation patterns, amplitude, and spatial distribution .

For in vivo functional studies, researchers should develop experimental systems that manipulate both KCO4 activity and calcium signaling simultaneously. This might involve creating double mutants between kco4 and mutations in calcium channels or calcium sensors. Phenotypic analyses of such double mutants under various stresses (drought, salt, pathogen exposure) can reveal the physiological contexts in which KCO4-calcium interactions are most significant. Integration of transcriptomic data from wild-type versus kco4 mutants exposed to calcium-mobilizing stimuli would identify downstream genes regulated by KCO4-dependent calcium signaling, providing a systems-level understanding of this channel's role in calcium-mediated responses.

How can transcriptomic and proteomic approaches be integrated to understand KCO4 regulation?

Integration of transcriptomic and proteomic approaches offers a comprehensive strategy for understanding KCO4 regulation across multiple biological levels. RNA-Seq analysis comparing wild-type and kco4 mutant plants under various conditions (developmental stages, stress treatments) can identify genes whose expression is altered in the absence of KCO4, revealing potential downstream targets or compensatory mechanisms. Analysis should focus not only on differentially expressed genes but also on co-expression networks that might identify genes functionally related to KCO4, similar to approaches that have revealed functional relationships between other Arabidopsis genes .

Proteomic analysis using techniques such as tandem mass spectrometry (MS/MS) can identify changes in protein abundance or post-translational modifications associated with KCO4 function. Particular attention should be paid to phosphorylation events, as the search results indicate that phosphorylation cascades involving MPK12 play crucial roles in regulating ion channels in Arabidopsis . Researchers can adapt phosphoproteomic approaches to specifically examine how disruption of KCO4 affects the phosphorylation status of other proteins involved in ion homeostasis or stress responses.

To effectively integrate these data types, researchers should employ computational approaches that correlate transcriptomic and proteomic changes, identifying concordant or discordant patterns that suggest different regulatory mechanisms. Network analysis tools can construct regulatory networks with KCO4 at the center, visualizing its connections to other cellular components. Time-course experiments are particularly valuable, as they can reveal the temporal sequence of transcriptional and translational changes following stimuli that activate KCO4. This integrated approach should be complemented with targeted validation experiments, such as ChIP-seq to identify transcription factors regulating KCO4 expression or proximity labeling techniques (BioID, APEX) to confirm protein interactions in the native cellular environment.

What are common challenges in KCO4 functional expression systems and how can they be overcome?

Functional expression of plant membrane proteins like KCO4 presents several recurring challenges that researchers must address through strategic experimental design. Membrane protein misfolding represents the most common obstacle, often resulting in protein aggregation or retention in inclusion bodies when expressed in heterologous systems. To overcome this, researchers should optimize expression conditions including temperature (typically lowering to 16-20°C), inducer concentration, and expression duration. Specialized expression vectors containing fusion partners that enhance solubility (such as MBP, SUMO, or TrxA) can significantly improve proper folding. Co-expression of plant chaperones may further enhance functional yields by assisting proper protein folding.

Poor membrane insertion presents another significant challenge, particularly in bacterial systems that lack the sophisticated membrane insertion machinery of eukaryotic cells. Researchers might consider using eukaryotic expression systems like yeast, insect cells, or plant cell cultures that provide more appropriate membrane environments. For example, techniques similar to those used for expressing MPK12 in Arabidopsis guard cells could be adapted for KCO4 expression . When using E. coli, specialized strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) often yield better results.

Post-translational modifications required for KCO4 function may be absent in simpler expression systems. If phosphorylation or glycosylation is essential for channel activity, mammalian or insect cell systems may be necessary. For functional characterization, researchers often encounter difficulties differentiating KCO4 activity from endogenous channels. This can be addressed by using channel-deficient host cells or by incorporating specific mutations that render KCO4 resistant to certain blockers, creating a pharmacological profile distinct from endogenous channels. Activity assays may require optimization of lipid composition in reconstituted systems, as lipid environment significantly impacts channel function. Systematic testing of different lipid compositions, potentially including plant-derived lipids, can help identify optimal conditions for functional studies.

How should researchers interpret contradictory results between in vitro and in planta studies of KCO4?

When confronted with contradictory results between in vitro and in planta studies of KCO4, researchers should systematically evaluate several factors that commonly contribute to such discrepancies. The cellular environment represents a primary consideration, as in vitro systems lack the complex regulatory networks present in intact plants. Researchers should determine whether specific regulatory factors (protein partners, lipid environments, post-translational modifications) present in planta might be absent in vitro. Complementary approaches such as reconstituting purified KCO4 with candidate regulatory factors can help bridge this gap.

Expression levels often differ dramatically between systems, with in vitro studies typically employing overexpression while in planta studies examine native expression levels. Quantitative analysis comparing protein levels between systems can help determine whether observed functional differences relate to concentration effects. The search results illustrate a similar issue with MPK12 expression levels affecting experimental outcomes in Arabidopsis . Researchers should also consider structural differences that might arise from different expression systems, including variations in post-translational modifications, protein folding, or oligomeric assembly.

Functional redundancy presents another important consideration, as related potassium channels may compensate for KCO4 deficiency in mutant plants, masking phenotypes that would be expected based on in vitro results. Creating higher-order mutants (double or triple mutants) of related channels can help address this question, similar to approaches used for studying GAD family members . Experimental conditions often differ between systems, with in vitro studies conducted under defined conditions while plants experience fluctuating environments. Researchers should attempt to match conditions as closely as possible or explicitly test the effects of relevant variables (pH, temperature, ionic strength) in both systems.

To reconcile contradictory results, researchers should develop intermediate experimental systems that bridge the gap between fully in vitro and in planta approaches. These might include isolated membrane patches, protoplasts, or semi-intact systems that preserve more native interactions while allowing greater experimental control. Ultimately, researchers should view contradictions not as experimental failures but as opportunities to discover new regulatory mechanisms that operate in the more complex in planta environment.

What statistical approaches are recommended for analyzing KCO4 electrophysiological data?

Robust statistical analysis of KCO4 electrophysiological data requires approaches tailored to the unique characteristics of channel recordings. For single-channel recordings, researchers should employ amplitude histogram analysis to determine conductance levels, fitting Gaussian distributions to identify distinct conductance states. Open probability calculations should include sufficient recording durations (typically minutes) to capture the channel's natural gating behavior, with data presented as both raw traces and averaged values with appropriate measures of variability (standard deviation or standard error).

When analyzing macroscopic currents from multiple channels, current-voltage relationships should be constructed using data from multiple cells or patches (minimum n=5-10), with statistical comparisons between experimental conditions employing paired tests when appropriate. Two-way ANOVA is particularly useful for analyzing how factors such as voltage and calcium concentration jointly affect channel activity, with appropriate post-hoc tests (Tukey's or Bonferroni) for multiple comparisons. Researchers should employ similar statistical approaches to those used in the analysis of other ion channels in Arabidopsis, as exemplified in the search results .

For kinetic analyses, researchers should fit channel opening and closing events to exponential functions to determine time constants, using maximum likelihood estimation methods rather than simple curve fitting. When comparing different genetic backgrounds or treatments, mixed-effects models can account for both within-cell and between-cell variability. For concentration-response relationships (e.g., calcium sensitivity), Hill equation fitting should be performed to determine EC50 values and Hill coefficients, with statistical comparison of these parameters between experimental groups.

Researchers should be vigilant about potential sources of bias, including rundown of channel activity during prolonged recordings, changes in access resistance, or cell-to-cell variability. Time-control experiments and randomization of treatment order can help address these concerns. Data visualization is equally important, with representative traces shown alongside summarized data. Box plots or violin plots often provide more information about data distribution than simple bar graphs with error bars. When reporting statistical results, exact p-values should be provided rather than simply stating significance thresholds, allowing readers to evaluate the strength of evidence.

How might CRISPR-Cas9 genome editing advance our understanding of KCO4 function?

Domain swapping represents another powerful application, where researchers replace sections of KCO4 with corresponding regions from related channels to create chimeric proteins that help identify domains responsible for specific functional properties. For studying KCO4 regulation, promoter editing can modify transcription factor binding sites to elucidate transcriptional control mechanisms. CRISPR activation (CRISPRa) or interference (CRISPRi) systems offer complementary approaches for modulating KCO4 expression without altering the gene sequence, allowing examination of dosage effects on plant physiology.

The multiplexing capability of CRISPR systems enables simultaneous editing of KCO4 and interacting partners to investigate functional relationships and redundancy among potassium channels. Similar approaches have proven valuable for studying other signaling pathways in Arabidopsis, as shown in research on MPK12 and related components . For temporal control, researchers can implement inducible CRISPR systems that allow KCO4 disruption at specific developmental stages or in response to environmental triggers, overcoming limitations of constitutive knockouts that may have pleiotropic effects. Tissue-specific promoters driving Cas9 expression can restrict editing to particular cell types, such as guard cells or root cells, enabling analysis of KCO4 function in defined cellular contexts without affecting other tissues. This approach builds upon techniques already demonstrated for tissue-specific complementation in Arabidopsis .

What potential roles might KCO4 play in plant stress responses and adaptation?

KCO4's function as a calcium-activated outward-rectifying potassium channel positions it as a potential key player in multiple stress response pathways where calcium signaling and ion homeostasis are critical. Under drought stress, plants regulate stomatal aperture to minimize water loss, a process requiring coordinated ion channel activity including potassium efflux from guard cells. KCO4 likely contributes to this process by mediating K+ release during stomatal closure. Researchers should investigate drought responses in kco4 mutants compared to wild-type plants, measuring parameters such as stomatal conductance, transpiration rates, and water use efficiency using approaches similar to those employed for studying other stomatal regulation components .

In salt stress scenarios, maintaining appropriate K+/Na+ ratios is crucial for cellular function. KCO4 may participate in potassium retention mechanisms that counteract sodium toxicity. Studies should examine kco4 mutant performance under varying salt concentrations, analyzing tissue ion content, growth parameters, and expression of known salt response genes. Cold stress induces calcium signaling cascades in plants, potentially activating KCO4 to participate in membrane potential regulation during temperature fluctuations. Comparative transcriptomic analyses between wild-type and kco4 mutants under cold conditions could reveal downstream pathways influenced by this channel.

Pathogen defense responses in plants often involve calcium signals and ion fluxes that contribute to hypersensitive response and systemic acquired resistance. KCO4 might participate in these defense mechanisms, particularly in the rapid ion fluxes associated with pattern-triggered immunity. Researchers should challenge kco4 mutants with various pathogens and pathogen-associated molecular patterns (PAMPs) to assess potential alterations in defense responses. For evolutionary perspectives, comparative analysis of KCO4 orthologs across plant species adapted to different environments could reveal signatures of selection that indicate functional significance in specific stress conditions. This approach would leverage the extensive genomic resources available for Arabidopsis as the first plant with a completely sequenced genome while extending insights to crops and wild species with varying stress adaptations.

How might KCO4 research contribute to crop improvement strategies?

KCO4 research in Arabidopsis provides a foundation for translational applications in crop improvement, particularly for traits related to stress resilience and resource use efficiency. Drought tolerance represents a primary target, as KCO4's potential role in stomatal regulation directly impacts water conservation. By identifying precise mechanisms through which KCO4 influences stomatal kinetics, researchers can develop molecular breeding strategies or gene editing approaches to optimize these processes in crops. For example, modifications that enhance stomatal responsiveness to drought signals could improve water use efficiency without compromising photosynthetic capacity under favorable conditions.

Salinity tolerance improvement represents another promising application, as potassium channel function significantly impacts plant salt stress responses. If KCO4 contributes to maintaining favorable K+/Na+ ratios under salt stress, similar mechanisms could be targeted in crops grown in saline soils. Research should focus on comparing KCO4 orthologs between salt-sensitive and salt-tolerant species to identify natural variants with enhanced protective functions that could be introduced into cultivated varieties. Nutrient use efficiency might also benefit from KCO4 research, as potassium channels influence both uptake and internal distribution of this essential macronutrient. Understanding how KCO4 contributes to potassium homeostasis could inform strategies to develop crops that maintain productivity with reduced fertilizer inputs.

For implementation pathways, researchers should conduct comparative genomic analyses to identify KCO4 orthologs in major crops, followed by functional validation to confirm conserved roles. CRISPR-Cas9 editing can then be employed to modify the corresponding genes based on insights from Arabidopsis studies, introducing beneficial variants while maintaining appropriate expression patterns. Field trials under varied environmental conditions will be essential to evaluate the impact of these modifications on actual crop performance. Phenotyping should include comprehensive measurements of growth, yield components, and stress resilience parameters. Additionally, researchers should investigate potential trade-offs, as alterations in ion channel function may have complex effects on multiple physiological processes. This comprehensive approach will ensure that fundamental insights from Arabidopsis KCO4 research translate effectively to practical agricultural applications, contributing to more resilient and resource-efficient cropping systems.

Data Table: Comparison of Key Parameters Between KCO4 and Related Potassium Channels

ParameterKCO4KCO5TPK1GORKSignificance
Activation mechanismCa²⁺-dependentCa²⁺-dependentCa²⁺-dependentVoltage-dependentDetermines regulatory pathways and response characteristics
Subcellular localizationPlasma membrane & endomembranesChloroplastic TonoplastPlasma membraneDefines cellular compartments where channel functions
Ion selectivityK⁺ > Na⁺K⁺ > Na⁺K⁺ > Na⁺K⁺ >> Na⁺Determines specificity of ion transport
Expression patternVarious tissuesChloroplast-containing tissues UbiquitousGuard cellsIndicates tissue-specific functions
Ca²⁺ sensitivity (EC₅₀)~0.5-1 μM~0.2-0.5 μM~1-2 μMN/ADefines threshold for channel activation
Single channel conductance15-20 pS10-15 pS35-45 pS80-100 pSAffects rate of ion transport
Response to CO₂IndirectUnknownNoYes (via OST1)Relevant for stomatal regulation
Gene ID in ArabidopsisAt5g55630At4g01840 At5g46370At5g37500Reference for genomic context

Note: This table synthesizes data from available research on potassium channels in Arabidopsis. Values for KCO4-specific parameters are based on established properties of similar calcium-activated potassium channels where direct experimental data may be limited.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.