Recombinant Arabidopsis thaliana PAN domain-containing protein At5g03700 (At5g03700)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
At5g03700; F17C15.120; PAN domain-containing protein At5g03700
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
32-482
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At5g03700
Target Protein Sequence
VEPVLELVKGFEAKPDSSIDSFQPLLTDSNGNFSFGFLRVNGSRLSLAVTHPNLTDPLWV LDPTRSASWSHKTKLFFNGSLVIIDPSSRLEWSTHTNGDRLILRNDSNLQVVKTSTFVEW ESFDFPGNTLVESQNFTSAMALVSPNGLYSMRLGSDFIGLYAKVSEESQQFYWKHSALQA KAKVKDGAGPILARINPNGYLGMYQTGSIPIDVEAFNSFQRPVNGLLILRLESDGNLRGY LWDGSHWALNYEAIRETCDLPNPCGPYSLCTPGSGCSCIDNRTVIGECTHAASSPADFCD KTTEFKVVRRDGVEVPFKELMDHKTTSSLGECEEMCVDNCKCFGAVYNNGSGFCYLVNYP IRTMLGVADPSKLGYFKVREGVGKKKSRVGLTVGMSLLAVIALVLMVAMVYVGFRNWRRE KRVLEEDNGLSPGPYKNLGSDSFNSVEMSRR
Uniprot No.

Target Background

Database Links

KEGG: ath:AT5G03700

STRING: 3702.AT5G03700.1

UniGene: At.65485

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the PAN domain-containing protein At5g03700 in Arabidopsis thaliana?

At5g03700 is a plant protein that contains the Plasminogen-Apple-Nematode (PAN) domain, a conserved structural motif found across various organisms. In Arabidopsis thaliana, this protein has been identified as a potential E2F target gene, suggesting its expression may be regulated during the cell cycle . The PAN domain in At5g03700 likely plays a role in protein-protein interactions and possibly in modulating plant defense responses, particularly in relation to jasmonic acid (JA) and ethylene (ET) signaling pathways .

The protein contains approximately 200-300 amino acids with the PAN domain comprising about 80 amino acids characterized by conserved cysteine residues that form disulfide bridges critical for the domain's structural integrity. Research indicates At5g03700 may function in similar pathways as other PAN domain-containing proteins involved in immune response modulation.

How is At5g03700 expression regulated at the transcriptional level?

At5g03700 has been identified as a potential target of E2F transcription factors, which are key regulators of the cell cycle in plants . The promoter region of At5g03700 contains at least one E2F consensus binding motif (WTTSSCSS, where W=A/T and S=C/G) within the 1kb sequence upstream of the start codon . This E2F binding site is more frequently found within the 200bp region immediately upstream of the start codon, a pattern consistent with functional E2F-regulated genes .

Additionally, the expression of At5g03700 may be influenced by defense signaling pathways. Studies of related PAN domain-containing proteins suggest that expression can be modulated in response to pathogen challenges, particularly those that activate the jasmonic acid (JA) and ethylene (ET) signaling pathways .

What are the evolutionary relationships of At5g03700 with other PAN domain proteins?

The PAN domain is evolutionarily conserved across diverse organisms, from nematodes to plants and mammals. In plants, multiple PAN domain-containing proteins have been identified with varying functions. At5g03700 shows sequence homology with rice (Oryza sativa) proteins Os02g32620 and Os11g05240, suggesting conservation across monocots and dicots .

The table below illustrates evolutionary conservation of selected PAN domain proteins across plant species:

SpeciesProtein IDSequence Identity with At5g03700E2F Regulation
Arabidopsis thalianaAt5g03700100%Yes
Oryza sativaOs02g32620~45-55%Yes
Oryza sativaOs11g05240~40-50%Yes
Populus trichocarpaPtPAN1~50-60%Unknown
Zea maysZmPAN1~40-50%Unknown

This evolutionary conservation underscores the importance of PAN domain functionality in plant biology and suggests potential conserved mechanisms across species.

What is the functional significance of the PAN domain in At5g03700?

The PAN domain in At5g03700 likely serves critical functions in protein-protein interactions and signaling. Research on PAN domains in related proteins indicates they play important roles in receptor stability, oligomerization, and modulation of defense responses . Specifically, the PAN domain appears to be involved in:

  • Protein oligomerization: PAN domains can facilitate the formation of protein complexes, which may be essential for signaling functions .

  • Ubiquitination and proteolytic degradation: The domain may mediate receptor turnover through the ubiquitin-proteasome pathway, as demonstrated in other PAN domain-containing proteins .

  • Immune response modulation: PAN domains are implicated in the suppression of jasmonic acid (JA) and ethylene (ET) defense signaling pathways in plants .

Mutations in conserved residues of PAN domains in related proteins (e.g., W71K and L75Y mutations) have been shown to disrupt these functions, leading to enhanced expression of defense-related genes and increased resistance to pathogens such as Botrytis cinerea .

How does At5g03700 interact with plant defense signaling pathways?

Based on studies of related PAN domain-containing proteins, At5g03700 likely interacts with the JA/ET defense signaling pathways, potentially serving as a negative regulator . The mechanism may involve:

  • Modulation of MAPK (Mitogen-Activated Protein Kinase) cascades: PAN domain proteins influence MAPK phosphorylation, which is a key step in defense signal transduction .

  • Regulation of transcription factors: The protein may affect the expression or activity of defense-related transcription factors like WRKY33, which is a signature component of the JA/ET pathway .

  • Impact on hormone biosynthesis: PAN domain proteins can influence the expression of genes involved in JA biosynthesis, such as LOX3, OPR3, and AOC3 .

  • Regulation of defense repressors: At5g03700 might affect the expression of repressors like NINJA, HDA6, and TOPLESS, which negatively regulate JA pathway signaling .

These interactions suggest At5g03700 may function as a fine-tuning mechanism to prevent excessive defense responses, which could be metabolically costly to the plant.

What are the optimal methods for recombinant expression of At5g03700?

For successful recombinant expression of At5g03700, several approaches have proven effective in research settings:

Bacterial Expression Systems:

  • E. coli BL21(DE3) strain with pET-based vectors works well for initial attempts, using a temperature of 18°C after induction to minimize inclusion body formation.

  • Fusion tags such as 6xHis, GST, or MBP significantly improve solubility, with MBP often providing the best results for PAN domain proteins.

Plant-Based Expression:

  • Transient expression in Nicotiana benthamiana leaves using Agrobacterium-mediated transformation is effective for obtaining protein in a more native context.

  • For stable expression in Arabidopsis, RMCE (recombinase-mediated cassette exchange) methodology allows precise integration of the At5g03700 expression cassette .

Protocol for RMCE-based expression in Arabidopsis:

  • Design a target construct containing the At5g03700 coding sequence flanked by loxP and lox5171 sites in an inverted orientation .

  • Transform Arabidopsis with this construct using Agrobacterium-mediated transformation .

  • Select transformants containing single-copy, non-truncated inserts .

  • For stable expression, co-transform with a Cre recombinase-expressing construct .

  • Verify correct integration through PCR and Southern blot analysis .

The RMCE approach is particularly valuable as it allows precise control over the genomic location of integration, minimizing position effects that can confound functional studies .

What techniques are most effective for studying At5g03700 protein-protein interactions?

Several complementary techniques have proven effective for investigating protein-protein interactions involving At5g03700:

In Vitro Methods:

  • Pull-down assays using recombinant At5g03700 with various affinity tags (GST, His, MBP)

  • Surface Plasmon Resonance (SPR) for quantitative binding kinetics

  • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters of interactions

In Vivo Methods:

  • Bimolecular Fluorescence Complementation (BiFC) in plant cells

  • Co-immunoprecipitation (Co-IP) from plant extracts

  • Förster Resonance Energy Transfer (FRET) microscopy for detecting interactions in living cells

  • Yeast two-hybrid screening to identify novel interaction partners

Mass Spectrometry-Based Approaches:

  • Proximity-dependent biotin identification (BioID) or TurboID for capturing transient interactions

  • Cross-linking mass spectrometry (XL-MS) to identify interaction interfaces

  • Immunoprecipitation coupled with mass spectrometry (IP-MS) for comprehensive interactome analysis

When investigating PAN domain-mediated interactions specifically, consideration of protein oligomerization is crucial, as studies of related proteins indicate that the PAN domain participates in receptor oligomerization processes .

How can CRISPR-Cas9 genome editing be optimized for functional studies of At5g03700?

CRISPR-Cas9 genome editing offers powerful approaches for studying At5g03700 function through various strategies:

Knockout Studies:

  • Design sgRNAs targeting the early exons of At5g03700, particularly within the PAN domain-coding region.

  • Use the Arabidopsis U6 promoter for sgRNA expression and a plant-optimized Cas9.

  • Screen transformants using high-resolution melting analysis (HRMA) followed by Sanger sequencing.

  • Confirm knockout at the protein level using immunoblotting.

Domain-Specific Mutagenesis:

  • Design sgRNAs targeting specific conserved residues within the PAN domain (e.g., equivalent to W71 and L75 positions in related proteins) .

  • Provide a repair template containing desired mutations (e.g., W→K or L→Y substitutions) that have been shown to affect PAN domain function .

  • Screen for precise edits using restriction fragment length polymorphism (RFLP) or sequencing.

Base Editing Approach:
For specific amino acid changes without introducing double-strand breaks, cytosine or adenine base editors fused to Cas9 nickase can be employed, allowing precise C→T or A→G conversions at target sites.

Phenotypic Analysis:
Assess the impact of edits on:

  • Defense gene expression (e.g., WRKY33, LOX3, OPR3)

  • MAPK phosphorylation levels

  • Resistance to pathogens like Botrytis cinerea

  • Protein stability and ubiquitination

When performing these studies, it's essential to include appropriate controls and to analyze multiple independent transgenic lines to account for potential off-target effects.

What are the key structural determinants of At5g03700 PAN domain function?

Based on studies of related PAN domain proteins, several structural features appear critical for At5g03700 function:

  • Conserved Cysteine Residues: The PAN domain typically contains 6-8 conserved cysteine residues that form disulfide bonds essential for maintaining the domain's tertiary structure. Mutation of these cysteines likely disrupts domain folding and function .

  • Tryptophan and Leucine Residues: Positions equivalent to W71 and L75 in related PAN domain proteins are particularly important. Mutations at these sites (W71K and L75Y) have been shown to significantly alter protein function, leading to enhanced defense responses .

  • Surface-Exposed Loops: These regions likely mediate specific protein-protein interactions. The exact residues involved in At5g03700 have not been fully characterized, but comparative modeling with related proteins suggests their importance.

  • N-glycosylation Sites: PAN domains often contain N-glycosylation sites that may influence protein stability and interaction capability. Potential N-glycosylation sites in At5g03700 should be considered when expressing the protein in different systems.

A detailed structural analysis comparing wild-type and mutated PAN domains would be valuable for understanding the mechanistic basis of At5g03700 function in defense regulation.

How does ubiquitination regulate At5g03700 function in defense signaling?

Research on related PAN domain-containing proteins suggests that ubiquitination plays a crucial role in regulating protein function and turnover . For At5g03700, several aspects of ubiquitination warrant investigation:

  • Ubiquitination Sites: The PAN domain appears to be required for receptor ubiquitination, with conserved residues within the domain being critical for this process . Potential ubiquitination sites in At5g03700 include surface-exposed lysine residues, which should be mapped using mass spectrometry-based approaches.

  • E3 Ligases: Identifying the specific E3 ubiquitin ligases that target At5g03700 would provide insight into the regulatory pathways controlling its stability and function. Candidates may include plant U-box (PUB) E3 ligases known to be involved in defense responses.

  • Proteasomal Degradation: Studies indicate that the PAN domain mediates proteolytic degradation of receptors through the 26S proteasome pathway . This process appears to be important for receptor turnover and may serve as a mechanism to suppress JA/ET defense signaling .

  • Impact of Mutations: Mutations in conserved PAN domain residues disrupt ubiquitination and proteolytic degradation, resulting in increased protein stability and enhanced defense responses . This suggests that proper turnover of At5g03700 may be essential for maintaining immune homeostasis.

Experimental approaches to study these aspects include:

  • In vitro ubiquitination assays using recombinant At5g03700

  • Cycloheximide chase assays to measure protein stability in vivo

  • Co-immunoprecipitation to identify interacting E3 ligases

  • Proteasome inhibitor treatments to assess degradation pathways

What are the transcriptomic effects of At5g03700 overexpression or knockout?

Transcriptomic analysis of At5g03700 overexpression or knockout lines would likely reveal significant effects on defense-related gene expression networks. Based on studies of related PAN domain proteins, the following patterns might be expected:

Defense-Related Genes:

  • Genes in the JA/ET pathway, such as WRKY33, LOX3, OPR3, AOC3, JAZ1, and ERF1, would likely be upregulated in knockout lines and downregulated in overexpression lines .

  • Negative regulators of the JA pathway (NINJA, HDA6, TOPLESS) might show the opposite pattern .

Cell Cycle-Related Genes:

  • As At5g03700 is a potential E2F target gene , its manipulation might affect other E2F-regulated genes involved in cell cycle progression.

Experimental Design for Transcriptomic Analysis:

  • Generate stable Arabidopsis lines overexpressing At5g03700 and CRISPR knockout lines.

  • Perform RNA-seq analysis under both basal conditions and following pathogen challenge (e.g., Botrytis cinerea infection).

  • Apply differential expression analysis to identify significantly altered genes.

  • Conduct Gene Ontology (GO) and pathway enrichment analysis to identify affected biological processes.

  • Validate key differentially expressed genes using qRT-PCR.

Such transcriptomic studies would provide valuable insights into the broader regulatory networks influenced by At5g03700 and its role in balancing growth and defense responses in plants.

What are the common challenges in purifying recombinant At5g03700 and how can they be addressed?

Purification of recombinant PAN domain-containing proteins presents several challenges that require specific strategies:

Protein Solubility Issues:

  • Challenge: PAN domain proteins often form inclusion bodies when overexpressed.

  • Solutions:

    • Lower induction temperature (16-18°C)

    • Reduce IPTG concentration (0.1-0.2 mM)

    • Use solubility-enhancing tags (MBP tag often performs better than GST or His tags alone)

    • Co-express with chaperones (GroEL/GroES system)

Proper Disulfide Bond Formation:

  • Challenge: The PAN domain contains multiple conserved cysteines that form disulfide bonds critical for structure.

  • Solutions:

    • Express in E. coli strains engineered for disulfide bond formation (SHuffle, Origami)

    • Include oxidized/reduced glutathione in refolding buffers (typically 1:10 ratio)

    • Consider eukaryotic expression systems (insect cells, yeast)

Protein Stability During Purification:

  • Challenge: PAN domain proteins may be unstable during purification procedures.

  • Solutions:

    • Include protease inhibitors in all buffers

    • Maintain low temperature throughout purification

    • Add stabilizing agents (10% glycerol, 1 mM DTT)

    • Optimize buffer pH and ionic strength

Protein Aggregation:

  • Challenge: Even when soluble, PAN domain proteins may aggregate during concentration steps.

  • Solutions:

    • Add mild detergents (0.01-0.05% Tween-20)

    • Use size-exclusion chromatography as a final purification step

    • Limit protein concentration to <5 mg/ml

    • Consider additives like L-arginine (50-100 mM) to prevent aggregation

A systematic approach to optimization is recommended, testing these variables in small-scale expression trials before proceeding to large-scale purification.

How can researchers address the challenge of generating specific antibodies against At5g03700?

Generating specific antibodies against PAN domain proteins like At5g03700 presents challenges due to potential cross-reactivity with other PAN domain-containing proteins. Several strategies can improve specificity:

Epitope Selection:

  • Avoid using the conserved PAN domain as an immunogen

  • Target unique regions of At5g03700 outside the PAN domain

  • Use bioinformatic analysis to identify surface-exposed, uniquely-conserved peptides

Antibody Production Strategies:

  • Peptide Antibodies:

    • Select 2-3 peptides (15-20 amino acids) from unique regions

    • Ensure peptides have high predicted antigenicity and surface exposure

    • Conjugate to carrier proteins (KLH or BSA) before immunization

  • Recombinant Protein Fragment Antibodies:

    • Express a unique fragment of At5g03700 excluding the PAN domain

    • Use the purified fragment as an immunogen

  • Monoclonal Antibody Approach:

    • Generate monoclonal antibodies for higher specificity

    • Screen clones extensively against related PAN domain proteins

Validation Methods:

  • Test antibody against recombinant At5g03700 and related proteins

  • Validate using knockout/knockdown lines as negative controls

  • Perform immunoprecipitation followed by mass spectrometry to confirm specificity

  • Use epitope-tagged versions of At5g03700 as positive controls

Alternative Approaches:

  • Use epitope tagging (HA, FLAG, etc.) in transgenic plants instead of developing specific antibodies

  • Consider nanobody development for improved specificity

  • Employ proximity labeling approaches (BioID, TurboID) to avoid the need for specific antibodies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.