Recombinant Arabidopsis thaliana Peptidyl-prolyl cis-trans isomerase FKBP42 (FKBP42)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
FKBP42; TWD1; UCU2; At3g21640; MIL23.21; Peptidyl-prolyl cis-trans isomerase FKBP42; PPIase FKBP42; 42 kDa peptidyl-prolyl isomerase; FK506-binding protein 42; AtFKBP42; Immunophilin FKBP42; Protein TWISTED DWARF 1; Protein ULTRACURVATA 2; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
FKBP42
Target Protein Sequence
MDESLEHQTQTHDQESEIVTEGSAVVHSEPSQEGNVPPKVDSEAEVLDEKVSKQIIKEGH GSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQPIELVLGKEKKELAGLAIGVASMKSGE RALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAAD RRKMDGNSLFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACL IKLKRYDEAIGHCNIVLTEEEKNPKALFRRGKAKAELGQMDSARDDFRKAQKYAPDDKAI RRELRALAEQEKALYQKQKEMYKGIFKGKDEGGAKSKSLFWLIVLWQWFVSLFSRIFRRH RVKAD
Uniprot No.

Target Background

Function
Peptidyl-prolyl cis-trans isomerases (PPIases) accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. FKBP42 modulates the vacuolar uptake of multidrug resistance-associated protein (MRP) substrates, reducing metolachlor-gluthathione conjugate (MOC-GS) uptake and enhancing 17β-estradiol 17-(β-D-glucuronide) (E217βG) uptake. It regulates cell elongation and orientation, acting as a positive regulator of PGP1-mediated auxin transport. FKBP42's interaction with PGP1 modulates drug efflux activity; interaction with NPA or quercetin prevents its physical and functional interaction with PGP1. It is essential for the proper localization of auxin-related ABCB transporters and plays a role in brassinosteroid (BR) signaling.
Gene References Into Functions
  1. TWISTED DWARF1 Mediates the Action of Auxin Transport Inhibitors on Actin Cytoskeleton Dynamics. PMID: 27053424
  2. FKBP42/TWD1 plays a specific role in the activation of BRI1 receptor kinase. PMID: 26808213
  3. TWISTED DWARF 1 Associates with BRASSINOSTEROID-INSENSITIVE 1 to Regulate Early Events of the Brassinosteroid Signaling Pathway. PMID: 26802250
  4. TWD1 immunophilin affects auxin transport and root growth by affecting B-group ABC transporters. PMID: 20971896
  5. X-ray structure of the cytoplasmic portion of FKBP42, comprising both the FKBP-like domain and the TPR domain at 2.85 Å resolution. PMID: 17045295
Database Links

KEGG: ath:AT3G21640

STRING: 3702.AT3G21640.1

UniGene: At.5664

Protein Families
FKBP-type PPIase family
Subcellular Location
Cell membrane; Single-pass type IV membrane protein. Vacuole membrane; Single-pass type IV membrane protein. Endoplasmic reticulum.

Q&A

What is FKBP42/TWD1 and what are its key structural domains?

FKBP42/TWISTED DWARF1 (TWD1) is an immunophilin-like FK506-binding protein in Arabidopsis thaliana. Its structure includes multiple functional domains that contribute to its diverse cellular functions. The protein contains at least one FK506-binding domain (FKBD), a tetratricopeptide repeat (TPR) domain, a calmodulin binding domain (CaM-BD), and an in-plane membrane anchor (IPM) . These structural features are conserved among "long" FKBPs found ubiquitously in eukaryotes, placing FKBP42 in a class of proteins that function in the folding and regulation of ABC transporters .

For recombinant protein expression, researchers typically clone the full-length coding sequence of FKBP42/TWD1 into appropriate vectors. As demonstrated in published protocols, the coding sequence can be cloned into pENTRY/SD/D-TOPO vector and subsequently subcloned into gateway-compatible vectors like pnYFP for BiFC experiments or pMALc2 for overlay assays .

What phenotypes result from FKBP42/TWD1 mutations in Arabidopsis?

Mutation of FKBP42/TWD1 causes distinctive dwarf and twisted-organ phenotypes in Arabidopsis thaliana . These phenotypic manifestations result from disrupted brassinosteroid (BR) signaling and defects in auxin transport. The twd1 mutant exhibits reduced sensitivity to brassinosteroids in various growth responses, including:

  • Reduced root elongation

  • Altered hypocotyl elongation responses to BR

  • Abnormal activation of the BZR1 transcription factor

Quantitative analyses of BR responses reveal that twd1 mutants have significantly impaired BZR1 dephosphorylation compared to wild-type plants. Without brassinolide treatment, twd1 accumulates a higher level of inactive, phosphorylated BZR1-CFP (57.6% phosphorylated) than wild-type (42.1% phosphorylated). Following treatment with 100 nM brassinolide for 20 minutes, BZR1-CFP in twd1 shows only partial dephosphorylation (88.3%), whereas wild-type shows nearly complete dephosphorylation (96.2%) .

How does FKBP42/TWD1 function in brassinosteroid signal transduction?

FKBP42/TWD1 is necessary for brassinosteroid signal transduction, functioning upstream of BIN2 kinase in the BR signaling pathway . Experimental evidence demonstrates that:

  • The twd1 mutant shows reduced BR sensitivity in growth responses and impaired activation of the BZR1 transcription factor.

  • Bikinin, an inhibitor of BIN2/GSK3 kinases, induces similar dephosphorylation of BZR1 in both wild-type and twd1 (99.1% and 98.0% dephosphorylated BZR1-CFP, respectively).

  • FKBP42/TWD1 physically interacts with the kinase domains of the BR receptor kinases BRI1 and BAK1, as demonstrated through in vitro and in vivo assays .

This evidence positions FKBP42/TWD1 as a specific regulator of BR signaling that acts at the receptor level rather than downstream at the BIN2 kinase level. The protein appears to be specifically required for the activation of the BRI1 receptor kinase while not affecting its localization to the plasma membrane .

What is the relationship between FKBP42/TWD1 and ABC transporters?

FKBP42/TWD1 directly regulates cellular trafficking and activation of multiple ATP-BINDING CASSETTE (ABC) transporters from the ABCB and ABCC subfamilies . This function is analogous to that of mammalian FKBP8/38, which facilitates post-translational folding of the ABCC7/CFTR chloride channel.

In Arabidopsis, FKBP42 functions in:

  • Processing of ABCB and ABCC transporters at the endoplasmic reticulum

  • Facilitating proper localization of these transporters to the plasma and vacuolar membranes

  • Ensuring subsequent functionality of these transporters at their destinations

The loss of FKBP42 contributes to the pronounced phenotypes observed in twd1 mutants, likely through disruption of multiple transporter functions including auxin transport mediated by ABCB transporters.

What methodologies are effective for studying FKBP42/TWD1 protein interactions?

Multiple complementary approaches can be employed to study FKBP42/TWD1 protein interactions:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Clone FKBP42 into pnYFP vector (35S:nYFP-FKBP42)

    • Transform constructs into Nicotiana benthamiana via Agrobacterium tumefaciens GV3101

    • Observe reconstituted fluorescence when interaction partners are expressed together

  • In vitro binding assays:

    • Express FKBP42 as a MBP fusion protein (35S:MBP-FKBP42)

    • Use purified protein for overlay assays with potential interaction partners

  • Co-immunoprecipitation:

    • Can be performed with antibodies against FKBP42 or epitope-tagged versions

    • Identify interaction partners through subsequent western blotting or mass spectrometry

  • Quantitative multiplexed mass spectrometry (QMS):

    • Label samples with isobaric tags to allow direct comparison of protein abundances

    • Analyze approximately 3,600 proteins to identify those potentially up-regulated in association with FKBP42

These approaches have successfully demonstrated interactions between FKBP42/TWD1 and BR receptor kinases BRI1 and BAK1, confirming its role in the BR signaling pathway .

How can researchers effectively analyze BR signaling in FKBP42/TWD1 mutants?

Analysis of BR signaling in FKBP42/TWD1 mutants requires multi-faceted approaches:

  • BZR1 phosphorylation analysis:

    • Express pBZR1:BZR1-CFP in both wild-type and twd1 backgrounds

    • Treat seedlings with brassinolide (BL), bikinin (BIN2 inhibitor), or mock treatments

    • Assess BZR1 phosphorylation status via western blotting

    • Quantify the percentage of phosphorylated versus dephosphorylated BZR1

  • Growth response assays:

    • Surface-sterilize seeds and plate on half-strength MS media with 1% sucrose, 0.8% Phytoblend agar

    • Include appropriate chemicals or hormones (e.g., brassinolide, bikinin)

    • Place plates vertically under constant light

    • Measure root lengths using ImageJ software

  • Gene expression analysis:

    • Perform quantitative RT-PCR of BR-responsive genes

    • Compare expression patterns between wild-type and twd1 mutants

    • Analyze how expression changes in response to BR treatment or other stimuli

This methodological framework enables researchers to determine precisely where in the BR signaling pathway FKBP42/TWD1 functions and how its absence affects signal transduction.

How does FKBP42/TWD1 influence cross-talk between BR and other signaling pathways?

FKBP42/TWD1 appears to influence cross-talk between brassinosteroid signaling and other pathways, particularly flagellin-mediated immunity signaling. Experimental evidence indicates that:

  • The twd1 mutant exhibits enhanced sensitivity to flagellin (flg22) treatment compared to wild-type:

    • Greater reduction in fresh weight after 7 days of flg22 treatment

    • Stronger MAPK activation after 10 and 30 minutes of flg22 treatment

    • Slightly higher expression of flagellin-induced genes (FRK1 and AT2G17740)

  • These enhanced flg22 responses suggest that:

    • FKBP42/TWD1 is not required for FLS2 and BAK1 functions in immunity signaling

    • FKBP42/TWD1 may negatively regulate flg22 responses either:
      a) Directly through interaction with BAK1 (which participates in both BR and flagellin signaling)
      b) Indirectly through reduced BR signaling, which is known to antagonize flagellin responses

This cross-talk has important implications for understanding how plants balance growth and defense responses, with FKBP42/TWD1 potentially serving as a regulatory node that influences this balance.

What challenges exist in producing and working with recombinant FKBP42/TWD1?

Working with recombinant FKBP42/TWD1 presents several methodological challenges:

  • Expression system selection:

    • The full-length protein contains multiple domains including a membrane anchor

    • Expression in E. coli may require optimization of codon usage and growth conditions

    • Alternative expression systems (insect cells, plant-based) may be needed for proper folding

  • Protein solubility and stability:

    • Membrane-associated proteins often present solubility challenges

    • Truncated versions lacking the membrane anchor may be more amenable to purification

    • Buffer optimization is critical for maintaining protein stability

  • Functional assays:

    • Recombinant protein must be properly folded to retain peptidyl-prolyl cis-trans isomerase activity

    • Activity assays should include appropriate controls to ensure functionality

    • Interaction studies require properly folded partner proteins (e.g., BRI1, BAK1 kinase domains)

  • Potential contamination:

    • When examining H-NPA binding properties, researchers must control for endogenous proteins

    • Quantitative multiplexed mass spectrometry can help identify potential contaminants or co-purifying proteins

How might FKBP42/TWD1 research inform agricultural applications?

Understanding FKBP42/TWD1 function has potential implications for crop improvement:

  • Brassinosteroid signaling optimization:

    • Modulating BR sensitivity could enhance plant growth while maintaining stress tolerance

    • Fine-tuning FKBP42 activity might allow optimization of BR responses without compromising defense

  • Plant architecture manipulation:

    • The dwarf and twisted phenotypes of twd1 mutants suggest FKBP42 as a target for modifying plant architecture

    • Partial attenuation of FKBP42 function could potentially create semi-dwarf crops with enhanced lodging resistance

  • Stress response engineering:

    • The role of FKBP42 in balancing BR and flagellin responses suggests its potential in engineering plants with improved balance between growth and defense

    • This could lead to crops with enhanced disease resistance without significant yield penalties

Research methodologies should focus on creating genetic variants with different levels of FKBP42 function rather than complete knockout or overexpression, as subtle modulation may provide optimal agronomic benefits.

How does FKBP42/TWD1 compare structurally and functionally to FKBPs in other species?

Comparative analysis of FKBP42/TWD1 across species reveals evolutionary conservation and functional divergence:

  • Structural conservation:

    • "Long" FKBPs containing FK506-binding domains, TPR domains, and membrane anchors are found ubiquitously in eukaryotes

    • Mammalian FKBP8/38 represents a functional analog, regulating CFTR folding and trafficking

  • Functional specialization:

    • While the general role in ABC transporter regulation is conserved, the specific transporters regulated differ

    • In mammals, FKBP8/38 regulates CFTR on the ER

    • In plants, FKBP42 regulates multiple ABCB and ABCC transporters and additionally participates in BR signaling

  • Methodological approach for comparative studies:

    • Heterologous expression of FKBP42 in non-plant systems to test functional conservation

    • Complementation studies using chimeric proteins with domains from different species

    • Structural biology approaches to compare binding interfaces and substrate specificity

This comparative approach can reveal fundamental principles of FKBP function across evolution while highlighting plant-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.