Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11A (PEX11A)

Shipped with Ice Packs
In Stock

Description

Role in Peroxisome Proliferation and Stress Response

PEX11A regulates peroxisome abundance through homooligomerization and heterooligomerization with other PEX11 isoforms. Overexpression of PEX11 genes in A. thaliana induces peroxisome proliferation, while silencing reduces peroxisome number .

PEX11A-Dependent Peroxisome Dynamics

Experimental ApproachObservationSource
OverexpressionIncreased peroxisome number and altered morphology.
Gene Silencing~40% reduction in peroxisome number; enlarged peroxisomes observed.
Salt Stress (NaCl)Upregulation of PEX11e (homologous to PEX11A); enhanced peroxisome proliferation.

Interactions and Pathway Integration

PEX11A interacts with other peroxisomal proteins to coordinate organelle dynamics. Key interactions include:

  • FIS1b: Required for peroxisome targeting of PEX11d and PEX11e .

  • DRP3A: Involved in peroxisome fission; simultaneous silencing with PEX11c–e reduces peroxisome number .

PEX11A Interaction Network

Interacting ProteinRole in Peroxisome DynamicsExperimental Evidence
PEX11bForms heterooligomers with PEX11A.Co-IP and pull-down assays .
FIS1bMediates peroxisome membrane remodeling.Localization studies .
DRP3AControls peroxisome fission.Gene silencing and imaging .

Evolutionary and Expression Insights

PEX11A exhibits conserved structural motifs across eukaryotes, including a hydrophobic N-terminal domain and a C-terminal tail critical for membrane anchoring . In A. thaliana, PEX11 genes show differential expression under stress, particularly in response to salinity .

Expression Patterns Under Stress

Stress ConditionPEX11 IsoformExpression ChangeBiological Relevance
Salt (NaCl)PEX11eUpregulatedEnhanced peroxisome proliferation for stress adaptation .
HypoxiaPEX11c–eModulatedLinked to submergence tolerance .

Recombinant Production and Applications

While direct evidence for recombinant A. thaliana PEX11A is sparse, methodologies from rat/human PEX11A production (e.g., E. coli expression with His-tag) may apply . Such recombinant proteins are typically used for:

  • Structural Studies: Crystallization to resolve membrane integration.

  • Functional Assays: In vitro analysis of peroxisome membrane remodeling.

Hypothetical Recombinant PEX11A Workflow

StepMethodologyPurpose
CloningPCR amplification of PEX11A ORF.Generate full-length coding sequence.
ExpressionE. coli systems (e.g., BL21(DE3)).Produce soluble or inclusion body protein.
PurificationNi-NTA affinity chromatography (His-tag).Isolate recombinant PEX11A.
Functional TestingCo-IP with FIS1b/DRP3A in A. thaliana.Validate interaction networks in planta.

Research Gaps and Future Directions

  1. Mechanistic Studies: How PEX11A modulates peroxisome membrane curvature remains unclear.

  2. Stress-Specific Roles: Delineate PEX11A’s contribution to peroxisomal β-oxidation under drought or salinity.

  3. Recombinant Tools: Develop fluorescent fusion proteins (e.g., GFP-PEX11A) for live-cell imaging.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX11A; PEX11-3; At1g47750; T2E6.18; Peroxisomal membrane protein 11A; Peroxin-11A; AtPEX11a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PEX11A
Target Protein Sequence
MATKAPEKITKPKDRDFLNHLETYLSKRDGVDKLLKISRYATKIILASSLIPETRSIIPR LKSFESSVGVSRKAFRLGKFVQDINALRSSRWDSNHELVLLIIAYGGEGLYYFVEQFIWL TKSGLIDAKHSKWLQKISAWAELVGYVGSVSIKIRDLRKLNDEESCVASTIEISVSRGLA CDGEDEKMKMIKEKKTLKVLSILQDLADGLMTIADIRDGKGVLSAPNVISSAGLFSAIVS THKNWISC
Uniprot No.

Target Background

Function
PEX11A is involved in peroxisomal proliferation, promoting peroxisomal duplication, aggregation, or elongation without fission.
Gene References Into Functions
  1. PEX11a and peroxisome formation are crucial in regulating stress responses and rapid cellular adaptation to environmental stimuli. PMID: 27208303
Database Links

KEGG: ath:AT1G47750

STRING: 3702.AT1G47750.1

UniGene: At.21602

Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in developing siliques.

Q&A

What is Arabidopsis thaliana PEX11A and how does it relate to other PEX11 proteins?

PEX11A is one of five PEX11 isoforms in Arabidopsis thaliana (PEX11a, PEX11b, PEX11c, PEX11d, and PEX11e). These proteins can be separated into three groups based on sequence homology: PEX11a, PEX11b, and PEX11c-e . Unlike mammals and fungi which have fewer PEX11 proteins, Arabidopsis evolved an expanded PEX11 family, suggesting more specialized or redundant functions in plants .

Phylogenetic analyses indicate that plant PEX11 proteins diverged before the evolutionary split between monocots and dicots. Arabidopsis PEX11a belongs to a subclade that also includes rice (Oryza sativa) PEX11-3 and PEX11-5 .

What is the subcellular localization of PEX11A in Arabidopsis?

PEX11A localizes exclusively to the peroxisomal membrane. When expressed as myc-tagged or GFP-tagged fusion proteins, AtPEX11a sorts directly from the cytosol to peroxisomes without trafficking through the endoplasmic reticulum . The membrane topology of PEX11A differs from other PEX11 isoforms - while the N-terminus of PEX11A faces the cytosol, its C-terminus, unlike other isoforms, faces the peroxisomal matrix . This unique topology may be significant for its specific functions in peroxisome dynamics.

Localization can be experimentally confirmed using:

  • Fluorescence microscopy with CFP/GFP-tagged PEX11A

  • Co-localization with known peroxisomal markers like YFP-PTS1

  • Immunobiochemical analysis of highly purified peroxisomal fractions

What is the expression pattern of PEX11A in Arabidopsis tissues?

PEX11A exhibits a highly specific expression pattern compared to other PEX11 isoforms:

PEX11 IsoformExpression Level in Various Tissues
PEX11aConstitutively low in most tissues; primarily detected in developing siliques
PEX11bLow in most tissues; higher in cauline leaves; upregulated during dark-to-light transitions
PEX11cHigh expression in multiple tissues
PEX11dHighest expression in leaf tissue
PEX11eHighest expression in seed tissue

Unlike other PEX11 isoforms, PEX11A transcripts were found only in developing siliques, suggesting a specialized role in reproductive or seed development processes .

How does PEX11A functionally differ from other Arabidopsis PEX11 isoforms?

Each PEX11 isoform induces distinct morphological changes when overexpressed:

PEX11 IsoformEffect on Peroxisome MorphologyCellular Function
PEX11aPeroxisome elongation followed by doubled peroxisome numberPromotes peroxisome duplication
PEX11bPeroxisome aggregation and roundingMay coordinate peroxisome positioning
PEX11cPeroxisome elongation without subsequent fissionElongation phase of peroxisome division
PEX11dPeroxisome elongation without subsequent fissionElongation phase of peroxisome division
PEX11eDoubled peroxisome number without visible elongationPromotes fission without elongation

PEX11A specifically promotes peroxisome elongation prior to duplication. This suggests a mechanistic difference compared to PEX11e, which doubles peroxisome numbers without visible elongation. The C-terminal dilysine motif present in PEX11c-e but absent in PEX11a may account for some of these functional differences .

What protein-protein interactions have been reported for PEX11A?

Bimolecular fluorescence complementation (BiFC) experiments in Arabidopsis suspension cells revealed:

  • PEX11A forms homo-oligomers with itself

  • PEX11A forms hetero-oligomers with all other PEX11 isoforms

  • PEX11A interacts with FIS1b (a fission protein) but not with FIS1a or DRP3A

These interactions position PEX11A within a protein network that regulates peroxisome division. The PEX11-FIS1b-DRP3A system appears to function cooperatively, where PEX11 proteins promote peroxisome elongation and recruitment of FIS1b to the peroxisome membrane, and FIS1b likely then recruits DRP3A to stimulate the final fission step .

What mechanistic model explains PEX11A function in peroxisome proliferation?

Current evidence supports a coordinated model for peroxisome division involving PEX11A:

  • PEX11 proteins (including PEX11A) contain an amphipathic helix that can remodel membranes by inducing curvature

  • During G2 phase of the cell cycle, peroxisomes sequentially enlarge, elongate, then double in number, correlating with peaks in PEX11 expression

  • PEX11A promotes the elongation phase of this process

  • Following elongation, fission proteins (FIS1b and DRP3A) are recruited to complete division

  • PEX11A's membrane remodeling capacity is conserved from yeast to humans

This mechanism is supported by experiments showing that mutations in the amphipathic helix region of PEX11 proteins abolish membrane remodeling activity in vitro and hamper peroxisome fission in vivo .

What experimental approaches are used to study PEX11A function?

Several complementary approaches have proven valuable:

  • Localization studies: CFP/GFP fusion proteins with fluorescence microscopy

  • Protein-protein interactions: Bimolecular fluorescence complementation (BiFC), chemical cross-linking, co-immunoprecipitation

  • Loss-of-function studies: RNA interference (RNAi) or targeted gene disruption

  • Gain-of-function studies: Overexpression using constitutive promoters (35S)

  • Membrane interaction assays: In vitro liposome binding and tubulation assays with purified proteins or peptides

  • Complementation studies: Expression of Arabidopsis PEX11A in yeast or other organisms lacking PEX11

  • Cell cycle synchronization: To study peroxisome dynamics during cell division

For recombinant protein production, epitope tags (His, myc) can be added, though care must be taken regarding tag placement to avoid interfering with targeting information .

What phenotypes result from PEX11A manipulation in plants?

Altering PEX11A expression levels has distinct effects:

Overexpression:

  • Increases peroxisome number

  • Causes peroxisome elongation prior to duplication

  • Induces peroxisome proliferation

Silencing:

The functional importance of PEX11 proteins is highlighted in mutant studies across species. In other organisms, cells lacking PEX11 homologs exhibit reduced numbers of enlarged and/or elongated peroxisomes .

How does PEX11A respond to environmental signals and light?

Light is a significant regulator of peroxisome proliferation in Arabidopsis:

  • PEX11b (but not PEX11a) is consistently upregulated during dark-to-light transitions in young seedlings

  • RNAi plants with reduced PEX11a show significantly elongated peroxisomes after 2-hour light treatment, suggesting PEX11a involvement in light-responsive peroxisome dynamics

  • Expression of different PEX11 isoforms responds differently to environmental stresses, though detailed stress-response profiles for PEX11A specifically remain to be fully characterized

This light-responsiveness connects peroxisome dynamics to photosynthetic activity and may be relevant for photorespiration functions.

What structural elements are critical for PEX11A function?

Key structural features of PEX11 proteins include:

  • An N-terminal amphipathic helix (Pex11-Amph) conserved from yeast to humans that associates with liposomes in vitro and induces membrane curvature

  • Transmembrane domains that anchor the protein in the peroxisomal membrane

  • Unique membrane topology: PEX11A's N-terminus faces the cytosol while its C-terminus faces the matrix (unlike other PEX11 isoforms)

  • PEX11A lacks the C-terminal dilysine motif present in PEX11c, PEX11d, and PEX11e

The membrane-remodeling capacity of the amphipathic helix is crucial for function; mutations abolishing this activity hamper peroxisome fission in vivo .

What are the best strategies for expressing recombinant PEX11A in heterologous systems?

For recombinant PEX11A expression:

  • Bacterial systems: The N-terminal soluble domain can be expressed in E. coli with a C-terminal His-tag, though full-length membrane proteins may require special conditions

  • Yeast systems: Arabidopsis PEX11A shows limited functional complementation in Saccharomyces cerevisiae pex11 null mutants compared to PEX11c and PEX11e, which significantly complement the growth phenotype on oleic acid

  • Plant systems: Biolistic bombardment of plant cells or stable transformation of Arabidopsis plants using binary vectors are effective approaches

  • Tag considerations: For membrane topology studies, epitope tags can be added to either terminus. The myc epitope is often appended to the N-terminus to avoid interfering with potential C-terminal targeting signals

  • Purification strategy: Standard affinity chromatography using His-tags works for soluble domains, while full-length membrane proteins require detergent extraction

How can interactions between PEX11A and other peroxisomal proteins be effectively studied?

Multiple complementary approaches can be employed:

  • Bimolecular Fluorescence Complementation (BiFC): Particularly effective for membrane proteins in their native environment. Split YFP fragments are fused to potential interaction partners and reassembly indicates proximity

  • Co-immunoprecipitation: Can detect stable protein complexes from cell lysates after appropriate solubilization of membrane proteins

  • Chemical cross-linking: Useful for capturing transient interactions and has revealed ternary heterocomplexes in mammalian systems

  • Yeast two-hybrid: More challenging for membrane proteins but can be adapted using split-ubiquitin systems

  • In vitro binding assays: Using purified proteins to test direct interactions

For BiFC experiments specifically, a table of known PEX11 protein interactions in Arabidopsis shows PEX11A interacts with all other PEX11 isoforms (PEX11a-e) and with FIS1b, but not with FIS1a or DRP3A .

What are the current limitations in PEX11A research and future directions?

Current knowledge gaps and future research priorities include:

  • Temporal regulation: Further characterization of cell-cycle-dependent PEX11A activity and its coordination with other PEX11 isoforms

  • Post-translational modifications: Little is known about potential phosphorylation or other modifications that might regulate PEX11A activity

  • Tissue-specific functions: The specialized expression of PEX11A in siliques suggests unique roles that remain to be fully elucidated

  • Interaction networks: Complete mapping of the peroxisome division interactome in plants

  • Physiological significance: Further investigation of phenotypes in knockout/knockdown lines, particularly under various stress conditions

  • Regulatory networks: Identification of transcription factors and signaling pathways that control PEX11A expression

  • Comparative studies: Additional cross-species functional analysis to understand evolutionary diversification of PEX11 proteins

Advanced genomic and proteomic approaches, combined with high-resolution imaging techniques, will be crucial for addressing these questions in future research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.