Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11B (PEX11B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX11B; PEX11-4; At3g47430; T21L8.180; Peroxisomal membrane protein 11B; Peroxin-11B; AtPEX11b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PEX11B
Target Protein Sequence
MSLDTVDKLVVFLAKRDGIDKLVKTFQYVAKLACWHVEATRPEAADRFKKWEVASGLSRK AFRTGRSLTGFNALRRNPGATPMIRFLAVLANSGEMVYFFFDHFLWLSRIGSIDAKLAKK MSFISAFGESFGYTFFIIIDCIFIKQRLKSLKKLQHSTDEPKEEIGAKISEIRGDIVMRL MGISANVADLLIALAEIHPNPFCNHTITLGISGLVSAWAGWYRNWPS
Uniprot No.

Target Background

Function

PEX11B is involved in peroxisomal proliferation. It promotes peroxisomal duplication, aggregation, or elongation without fission.

Gene References Into Functions
  1. Light-induced peroxisome proliferation in Arabidopsis seedlings; PEX11B plays a key role in this process. PMID: 18203870
Database Links

KEGG: ath:AT3G47430

STRING: 3702.AT3G47430.1

UniGene: At.35807

Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, leaves and developing siliques.

Q&A

What is the function of PEX11B in Arabidopsis thaliana peroxisome dynamics?

PEX11B is a peroxisomal membrane protein that plays a critical role in regulating peroxisome proliferation in Arabidopsis thaliana. It is one of five PEX11 isoforms (PEX11a to PEX11e) in Arabidopsis that promote peroxisome elongation and population increase, though with differing specificities and some functional redundancy .

PEX11B specifically functions in the early stages of peroxisome division, primarily involved in peroxisome elongation and tubulation. When overexpressed, PEX11B significantly increases peroxisome abundance, while reduction in PEX11B expression through RNA interference (RNAi) decreases peroxisome numbers . Among the five Arabidopsis PEX11 isoforms, PEX11B is uniquely and strongly up-regulated by light, suggesting its specialized role in light-mediated peroxisome proliferation .

Experimental evidence confirms that PEX11B-silenced plants show minimal changes in peroxisome morphology upon light exposure, while wild-type plants exhibit significant peroxisome elongation under the same conditions. This indicates that PEX11B is essential for light-induced peroxisome proliferation during seedling photomorphogenesis .

How is PEX11B expression regulated in Arabidopsis thaliana?

PEX11B expression in Arabidopsis is primarily regulated by light through a specific photoreceptor-mediated signaling pathway. The expression of PEX11B is very low in dark-grown seedlings but increases substantially after exposure to light, reaching maximum levels at approximately 4 hours post-illumination before starting to decline by 12 hours .

The far-red light receptor phytochrome A (phyA) and the bZIP transcription factor HY5 HOMOLOG (HYH) are both required for the up-regulation of PEX11B in response to light. Molecular evidence demonstrates that HYH protein can directly bind to the promoter of PEX11B, indicating that PEX11B is a direct transcriptional target of HYH .

Different light wavelengths affect PEX11B expression to varying degrees. Compared to dark conditions, far-red light confers the strongest up-regulation (2.3-fold increase), followed by blue light (1.7-fold), white light (1.5-fold), and red light (1.3-fold). This wavelength-specific response pattern further supports the involvement of specific photoreceptors in PEX11B regulation .

What experimental approaches can be used to visualize PEX11B localization?

Researchers can employ several complementary approaches to visualize PEX11B localization:

  • Fluorescent protein fusion constructs: Creating cyan fluorescent protein (CFP) or yellow fluorescent protein (YFP) fusions with PEX11B allows direct visualization in living cells. These fusion proteins can be expressed under the control of the 35S constitutive promoter in plants already expressing a peroxisomal marker such as YFP-PTS1 (yellow fluorescent protein fused with the peroxisomal targeting signal type 1) .

  • Immunofluorescence microscopy: Using antibodies specific to PEX11B or to epitope tags (when working with tagged recombinant proteins) allows detection of the endogenous or recombinant protein in fixed cells.

  • Co-localization studies: Employing dual fluorescence imaging with established peroxisomal markers (like CFP-SKL) confirms peroxisomal membrane localization. For example, research has shown that YFP-PEX11 fusion proteins localize to ring-like structures that surround the matrix marker CFP-SKL, consistent with membrane localization .

  • Subcellular fractionation: Biochemical isolation of highly purified peroxisomes followed by immunoblot analysis can provide additional confirmation of PEX11B's peroxisomal localization.

All five Arabidopsis PEX11 proteins, including PEX11B, have been demonstrated to target to peroxisomes using these approaches .

What is the molecular mechanism of PEX11B-mediated peroxisome proliferation?

The detailed molecular mechanism of PEX11B-mediated peroxisome proliferation in Arabidopsis is still being elucidated, but current research provides several key insights:

PEX11B functions primarily in the early stages of peroxisome division, specifically in peroxisome elongation and tubulation, which are prerequisites for subsequent division events. The protein is an integral membrane protein of the peroxisome, where it likely alters membrane curvature to facilitate organelle elongation .

A notable feature of the PEX11B-mediated pathway in Arabidopsis is its integration with light signaling. The molecular evidence establishes a signaling cascade where:

  • Light activates phytochrome A (phyA)

  • Activated phyA triggers downstream signaling components

  • The bZIP transcription factor HYH binds directly to the PEX11B promoter

  • Increased PEX11B expression leads to peroxisome proliferation

This pathway represents a novel branch of phyA-mediated light signaling that specifically promotes peroxisome proliferation during seedling photomorphogenesis .

Unlike yeast, which contains multiple protein families specifically involved in peroxisome proliferation (Pex25p/Pex27p, Pex28p/Pex29p, Pex30p/Pex31p/Pex32p), Arabidopsis appears to rely primarily on the PEX11 family for this process. The Arabidopsis genome does not contain obvious sequence homologs to these additional yeast peroxisome proliferation factors .

How does Arabidopsis PEX11B compare functionally to other PEX11 family members?

The Arabidopsis PEX11 protein family consists of five members (PEX11a, PEX11b, PEX11c, PEX11d, and PEX11e) that display both shared and distinct functional characteristics:

PEX11 IsoformLight RegulationAbility to Complement Yeast pex11 MutantMembrane AssociationUnique Features
PEX11aNot strongly light-regulatedCannot complementIntegral membrane proteinConstitutively expressed
PEX11bStrongly light-inducedCannot complementIntegral membrane proteinEssential for light-induced peroxisome proliferation
PEX11cNot strongly light-regulatedCan complementIntegral membrane proteinFunctional in heterologous systems
PEX11dNot strongly light-regulatedCannot complementIntegral membrane proteinLimited functional data available
PEX11eNot strongly light-regulatedCan complementIntegral membrane proteinCan increase peroxisome number in yeast

All five Arabidopsis PEX11 proteins promote peroxisome proliferation when overexpressed and cause decreased peroxisome abundance when their expression is reduced through RNA interference .

The key distinguishing feature of PEX11B is its strong up-regulation in response to light, particularly far-red light. This makes PEX11B uniquely positioned as a mediator of light-induced peroxisome proliferation during seedling development .

Interestingly, only PEX11c and PEX11e can functionally complement the growth phenotype of the Saccharomyces cerevisiae pex11 null mutant on oleic acid medium, while PEX11a, PEX11b, and PEX11d cannot. This suggests functional divergence among the family members and potential specialization for plant-specific processes .

What experimental strategies can be used to produce and purify recombinant Arabidopsis PEX11B?

Producing recombinant Arabidopsis PEX11B presents challenges due to its integral membrane protein nature. Below are methodological approaches for successful expression and purification:

Expression Systems:

  • Bacterial expression (E. coli): May be suitable for truncated soluble domains but challenging for full-length protein due to its hydrophobic nature. Consider using specialized strains (C41/C43) designed for membrane protein expression.

  • Yeast expression (P. pastoris, S. cerevisiae): These eukaryotic systems can provide appropriate membrane insertion machinery and post-translational modifications. Research indicates that while Arabidopsis PEX11B cannot complement the yeast pex11 null mutant functionally, it can still be expressed in this system .

  • Insect cell expression: Baculovirus-mediated expression in Sf9 or Hi5 cells offers advantages for membrane protein production.

  • Plant-based expression: Native environment using Arabidopsis cell cultures or Nicotiana benthamiana transient expression can maintain natural folding and modification.

Purification Strategy:

  • Affinity tags: Engineer N- or C-terminal tags (His6, GST, MBP) for purification, considering that the N-terminus likely faces the cytosol.

  • Detergent screening: Systematically test mild detergents (DDM, LMNG, CHAPS) for extraction while maintaining protein integrity.

  • Membrane isolation: First isolate peroxisomal membranes before detergent solubilization to improve purity.

  • Size exclusion chromatography: As a polishing step to remove aggregates and ensure homogeneity.

When designing constructs, consider that experimental evidence shows PEX11B is an integral membrane protein . Including appropriate fusion partners (e.g., GFP) can aid in monitoring expression and purification efficiency.

How is PEX11B involved in plant stress responses?

While the role of PEX11B in light-mediated peroxisome proliferation is well established, its involvement in stress responses is less directly documented but supported by several lines of evidence:

Peroxisomes are critical organelles for detoxification of reactive oxygen species (ROS), particularly through catalase activity. The increase in peroxisome number mediated by PEX11B could potentially enhance cellular capacity to manage oxidative stress .

Research has shown that PEX11e, another member of the Arabidopsis PEX11 family, is upregulated in response to salt stress, and this correlates with increased peroxisome number . Given the functional overlap among PEX11 family members, PEX11B might play similar roles in stress conditions.

The light-dependent regulation of PEX11B is particularly relevant in the context of photoxidative stress. When plants are exposed to high light intensities, increased photosynthetic activity can generate excessive ROS. The phyA-HYH-PEX11B signaling cascade may represent an adaptive response to increase peroxisome proliferation to manage this stress .

What approaches can be used to investigate the interacting partners of PEX11B?

Understanding the protein interaction network of PEX11B is crucial for elucidating its precise function in peroxisome proliferation. Several complementary approaches can be employed:

1. Yeast Two-Hybrid (Y2H) Screening:

  • Use full-length PEX11B or specific domains as bait against Arabidopsis cDNA libraries

  • Consider membrane-based Y2H systems optimized for membrane proteins

  • Validate interactions with directed Y2H assays using known peroxisomal proteins

2. Co-Immunoprecipitation (Co-IP):

  • Express epitope-tagged PEX11B in Arabidopsis

  • Perform Co-IP followed by mass spectrometry to identify interacting proteins

  • Use crosslinking agents to capture transient interactions

  • Include appropriate controls with other PEX11 family members to identify specific vs. common interactors

3. Proximity-Based Labeling:

  • Fuse PEX11B to BioID or APEX2 enzymes

  • These enzymes will biotinylate proteins in close proximity to PEX11B in vivo

  • Purify biotinylated proteins and identify by mass spectrometry

4. Fluorescence Resonance Energy Transfer (FRET):

  • Generate fluorophore-tagged candidate interacting proteins

  • Measure FRET efficiency in planta to confirm direct interactions

  • Particularly useful for confirming specific interactions identified through other methods

5. Split-Ubiquitin System:

  • Particularly suitable for membrane proteins like PEX11B

  • Can detect interactions in the native membrane environment

Based on known peroxisome division mechanisms, candidate interacting partners might include other peroxisomal membrane proteins, components of the dynamin-related protein machinery involved in membrane fission, or proteins in the light signaling pathway such as HYH .

The investigation of protein-protein interactions should be complemented with analyses of lipid interactions, as PEX11B likely interacts with specific membrane lipids to induce membrane curvature during peroxisome elongation.

How does light quality influence PEX11B expression and peroxisome proliferation?

Light quality has a significant differential effect on PEX11B expression and consequent peroxisome proliferation in Arabidopsis. Quantitative analysis from GENEVESTIGATOR database reveals the following pattern of PEX11B upregulation compared to dark conditions :

Light QualityFold Increase in PEX11B Expression
Far-red light2.3-fold
Blue light1.7-fold
White light1.5-fold
Red light1.3-fold

This wavelength-specific response pattern is particularly interesting from a photobiology perspective. The strongest induction by far-red light (wavelength ~730 nm) implicates phytochrome A (phyA) as the primary photoreceptor mediating this response, which has been experimentally confirmed using phyA mutants .

The kinetics of PEX11B induction following light exposure shows a characteristic pattern: expression is very low in dark-grown seedlings, increases steadily after light exposure, reaches maximum levels at approximately 4 hours, and begins to decline by 12 hours. This temporal profile correlates well with the observed light-dependent alterations in peroxisome morphology and abundance .

Researchers studying PEX11B should consider these wavelength-specific and temporal aspects when designing experiments. For maximum PEX11B induction, far-red light treatment for 4 hours would be optimal based on the available data.

What genetic approaches can be used to study PEX11B function in planta?

Several genetic approaches can be employed to investigate PEX11B function in Arabidopsis:

1. Loss-of-Function Approaches:

  • T-DNA insertional mutants: Screen existing collections for insertions in the PEX11B gene

  • CRISPR/Cas9 gene editing: Generate precise knockouts of PEX11B

  • RNA interference (RNAi): Previously successful in reducing PEX11B transcript levels

  • Artificial microRNA: For more specific gene silencing with fewer off-target effects

2. Gain-of-Function Approaches:

  • Overexpression under constitutive promoters: 35S::PEX11B constructs have been used to demonstrate increased peroxisome proliferation

  • Inducible expression systems: Use estradiol or dexamethasone-inducible promoters to control timing of PEX11B expression

  • Tissue-specific overexpression: Target PEX11B overexpression to specific tissues to study localized effects

3. Complementation Experiments:

  • Mutant complementation: Express PEX11B in PEX11B-deficient plants to confirm phenotype causality

  • Rescue of phyA or hyh mutants: Overexpression of PEX11B in these mutants has been shown to rescue peroxisome abundance defects, confirming regulatory relationships

  • Domain swapping: Replace domains of PEX11B with corresponding regions from other PEX11 family members to identify functional regions

4. Reporter Systems:

  • Promoter-reporter fusions: PEX11B promoter driving fluorescent proteins to study expression patterns

  • Peroxisome markers: Combine genetic manipulations with peroxisomal markers (e.g., YFP-PTS1) to visualize effects on peroxisome dynamics

When designing genetic studies, researchers should consider the functional redundancy among PEX11 family members. Single gene disruptions might show subtle phenotypes due to compensation by other family members. Higher-order mutants may be necessary to observe strong phenotypes related to peroxisome proliferation.

How can computational approaches aid in understanding PEX11B structure and function?

Computational approaches offer valuable insights into PEX11B structure and function, especially given the challenges of experimental structural determination for membrane proteins:

1. Sequence Analysis and Evolutionary Studies:

  • Multiple sequence alignment of PEX11 proteins across species reveals conserved functional domains

  • Phylogenetic analysis can identify evolutionary relationships and functional divergence

  • Construction of hidden Markov models (HMMs) can help identify distant homologs

2. Structural Prediction:

  • Membrane topology prediction using algorithms like TMHMM, Phobius, or TOPCONS

  • Ab initio or homology-based 3D structure prediction using AlphaFold2 or RoseTTAFold

  • Molecular dynamics simulations to study membrane interactions and conformational changes

3. Functional Motif Identification:

  • Prediction of post-translational modification sites

  • Identification of protein-protein interaction motifs

  • Analysis of membrane-interacting regions (amphipathic helices, hydrophobic patches)

4. Systems Biology Approaches:

  • Network analysis to predict functional associations

  • Integration of transcriptomic data to identify co-regulated genes

  • Gene Ontology enrichment analysis to infer biological processes

5. Promoter Analysis:

  • Identification of regulatory elements in the PEX11B promoter

  • Prediction of transcription factor binding sites, particularly for light-responsive elements

  • Comparative genomics of promoter regions across species

When applying computational approaches to PEX11B, researchers should pay particular attention to:

  • Membrane-interacting domains that might drive membrane curvature

  • Conserved regions across PEX11 family members that indicate core functional domains

  • Plant-specific features not present in yeast or mammalian homologs

  • Light-responsive elements in the promoter region that mediate phyA/HYH regulation

What methods can be used to quantify peroxisome proliferation in response to PEX11B manipulation?

Accurate quantification of peroxisome proliferation is essential for assessing PEX11B function. Multiple complementary approaches can be employed:

1. Microscopy-Based Quantification:

  • Confocal microscopy with fluorescent peroxisome markers: Count peroxisomes labeled with markers like YFP-PTS1 in fixed cell volumes

  • High-content screening: Automated image acquisition and analysis for higher throughput

  • 3D reconstruction: Z-stack imaging to capture all peroxisomes within a cell volume

  • Time-lapse imaging: To track dynamic changes in peroxisome number and morphology

2. Biochemical Approaches:

  • Peroxisome isolation and counting: Using density gradient centrifugation

  • Flow cytometry: Of isolated peroxisomes labeled with fluorescent markers

  • Western blotting: Quantification of peroxisomal marker proteins as proxy for peroxisome abundance

3. Quantitative Parameters to Measure:

  • Peroxisome density: Number of peroxisomes per unit cell area or volume

  • Peroxisome morphology: Categorize as spherical, elongated, or constricted

  • Size distribution: Measure peroxisome diameter or surface area

  • Clustering patterns: Analyze spatial distribution within cells

Published research has used confocal microscopy to measure peroxisome density in Arabidopsis cotyledon cells, reporting quantitative values that can serve as reference points :

Genetic BackgroundPeroxisome Density (peroxisomes/mm²)Statistical Significance
Wild-type (light-grown)13,853.7 ± 2,098.3Reference
phyA mutant615.5 ± 523.2P < 0.001
hyh mutant1,846.7 ± 369.3P < 0.001
cry1 mutant12,311.4 ± 2,154.5P = 0.1047 (not significant)

These values demonstrate the dramatic effect of phyA and hyh mutations on peroxisome abundance and provide benchmarks for evaluating PEX11B experimental manipulations .

How can researchers investigate the kinetics of PEX11B-mediated peroxisome proliferation?

Investigating the kinetics of PEX11B-mediated peroxisome proliferation requires temporal resolution of both PEX11B expression and subsequent peroxisome dynamics:

1. Temporal Analysis of PEX11B Expression:

  • RT-PCR or qRT-PCR: Measure PEX11B transcript levels at different time points after stimulation (e.g., light exposure)

  • Western blotting: Track PEX11B protein levels over time

  • Fluorescent reporter systems: Use PEX11B promoter driving destabilized fluorescent proteins for real-time monitoring

2. Peroxisome Dynamics Visualization:

  • Time-lapse confocal microscopy: Track labeled peroxisomes in living cells

  • Photoactivatable fluorescent proteins: Pulse-chase labeling of peroxisome populations

  • FRAP (Fluorescence Recovery After Photobleaching): To study membrane protein dynamics

3. Inducible Expression Systems:

  • Chemical induction: Use estradiol or dexamethasone-inducible PEX11B expression

  • Optogenetic tools: Light-controlled expression for precise temporal control

  • Heat-shock promoters: For rapid induction of PEX11B expression

4. Data Analysis Approaches:

  • Growth curve modeling: Apply mathematical models to peroxisome proliferation kinetics

  • Single-cell tracking: Follow individual peroxisomes through division events

  • Population statistics: Analyze the distribution of peroxisome morphologies over time

Previous research has established that after light exposure, PEX11B expression increases steadily, reaches maximum levels at approximately 4 hours, and begins to decline by 12 hours . This expression pattern correlates with observed changes in peroxisome morphology, with elongated peroxisomes appearing first, followed by an increase in peroxisome number.

A comprehensive kinetic analysis should capture multiple phases of the process:

  • Initial signaling events (phyA activation)

  • Transcriptional upregulation of PEX11B

  • PEX11B protein accumulation in peroxisome membranes

  • Peroxisome elongation phase

  • Peroxisome constriction

  • Final fission events

What are the critical controls needed when studying recombinant PEX11B?

When studying recombinant PEX11B, rigorous controls are essential to ensure experimental validity and avoid misinterpretation of results:

1. Expression Controls:

  • Empty vector controls: For all expression experiments

  • Unrelated membrane protein control: To distinguish PEX11B-specific effects from general membrane protein overexpression effects

  • Other PEX11 family members: To identify isoform-specific vs. general PEX11 functions

  • Expression level verification: Confirm similar expression levels when comparing different constructs

2. Localization Controls:

  • Known peroxisomal markers: Co-expression with established markers like PTS1-tagged fluorescent proteins

  • Other organelle markers: To confirm specificity of peroxisomal targeting

  • Topology controls: Proteolytic protection assays to confirm membrane orientation

  • Fractionation controls: Biochemical verification of peroxisomal localization

3. Functional Assay Controls:

  • Light condition controls: Dark vs. specific light wavelengths when studying light-dependent effects

  • Developmental stage controls: Use plants/tissues at equivalent developmental stages

  • Temporal controls: Include appropriate time-course measurements

  • Genetic background controls: Use appropriate wild-type and mutant backgrounds

4. Molecular Biology Controls:

  • Tag-only controls: When using tagged versions of PEX11B

  • Tag position controls: N-terminal vs. C-terminal tags may affect function differently

  • Domain mutation controls: Targeted mutations to verify functional domains

  • mRNA/protein stability controls: Ensure differences are not due to altered stability

5. Critical Negative Controls:

  • PEX11B RNAi or knockout lines: As negative controls for PEX11B-specific effects

  • phyA and hyh mutants: As negative controls for light-dependent regulation

  • Pharmacological inhibitors: Of pathways involved in peroxisome biogenesis

When designing experiments with recombinant PEX11B, researchers should be particularly cautious about:

  • Possible artifacts from protein overexpression

  • Potential interference from fusion tags

  • Functional redundancy with other PEX11 family members

  • Light conditions that might affect endogenous PEX11B expression

How can PEX11B research contribute to understanding plant developmental processes?

Research on PEX11B offers several significant insights into plant developmental processes:

1. Photomorphogenesis:
PEX11B research has revealed a novel branch of the phytochrome A (phyA) signaling pathway involving the transcription factor HYH that specifically regulates peroxisome proliferation during seedling development in response to light . This establishes peroxisome dynamics as an integral component of photomorphogenesis, the process by which light shapes plant development.

2. Organelle Biogenesis Regulation:
The light-dependent regulation of PEX11B demonstrates how environmental signals can directly influence organelle abundance and morphology. This provides a model system for studying environment-responsive organelle dynamics during development.

3. Metabolic Transitions:
Peroxisomes play crucial roles in fatty acid β-oxidation during seed germination and in photorespiration during photosynthetic growth. PEX11B-mediated peroxisome proliferation may facilitate these metabolic transitions during seedling establishment.

4. Cell-Type Specific Development:
By studying PEX11B expression patterns in different tissues and cell types, researchers can gain insights into how peroxisome abundance is tailored to the metabolic needs of specific cell types during development.

5. Integration with Hormonal Signaling:
Investigating potential crosstalk between light signaling through PEX11B and plant hormone pathways could reveal how peroxisome dynamics are coordinated with other developmental processes controlled by plant hormones.

6. Evolutionary Perspectives:
Comparative studies of PEX11B function across plant species can illuminate the evolution of light-responsive peroxisome proliferation as an adaptation to terrestrial environments where light is a critical developmental cue.

Understanding PEX11B-mediated peroxisome proliferation in development has practical implications for crop improvement, as optimizing peroxisome function could potentially enhance seedling establishment and photosynthetic efficiency.

What is known about the evolutionary conservation of PEX11B function across species?

The evolutionary analysis of PEX11B reveals both conservation and divergence across eukaryotic lineages:

  • Only some Arabidopsis PEX11 proteins (PEX11c and PEX11e, but not PEX11a, PEX11b, and PEX11d) can complement the yeast pex11 null mutant

  • PEX11B in Arabidopsis has evolved light-dependent regulation not present in non-photosynthetic organisms

3. Structural Features:
All PEX11 proteins are peroxisomal membrane proteins with conserved membrane-spanning domains. Computational analysis using hidden Markov models (HMMs) can identify structural commonalities across distant homologs .

4. Regulatory Divergence:
The light-dependent regulation of Arabidopsis PEX11B through phyA and HYH represents a plant-specific innovation linking peroxisome proliferation to photomorphogenesis . This exemplifies how a conserved cellular process (peroxisome division) has been integrated into lineage-specific signaling networks.

5. Evolutionary Implications:
The fact that plants rely primarily on the PEX11 family for peroxisome proliferation, while lacking obvious homologs to other yeast peroxisome proliferation factors (Pex25p/Pex27p, Pex28p/Pex29p, Pex30p/Pex31p/Pex32p), suggests evolutionary divergence in the molecular machinery controlling peroxisome abundance .

This evolutionary perspective on PEX11B highlights how fundamental cellular processes can be adapted and integrated into new regulatory networks as organisms evolve to occupy different ecological niches.

How might PEX11B research contribute to agricultural applications?

Research on PEX11B has several potential agricultural applications that could impact crop improvement strategies:

2. Photosynthetic Efficiency:
Peroxisomes house photorespiration enzymes that salvage carbon lost during the oxygenase activity of Rubisco. Optimizing peroxisome dynamics through PEX11B manipulation might contribute to more efficient photorespiration, particularly under conditions that favor photorespiration (high temperature, drought).

3. Seedling Establishment:
The light-regulated induction of PEX11B during seedling development suggests its importance during this critical phase . Enhancing seedling vigor through optimized peroxisome function could improve crop establishment, especially under suboptimal conditions.

4. Oil Seed Crop Improvement:
Peroxisomes are essential for fatty acid β-oxidation during seed germination. Understanding and optimizing PEX11B function could potentially improve germination rates and seedling vigor in oil seed crops like canola, soybean, and sunflower.

5. Light Response Optimization:
PEX11B's role in the phyA signaling pathway offers insights into light-responsive adaptation . This knowledge could inform strategies for optimizing crop responses to different light conditions, which is relevant for both field cultivation and controlled environment agriculture.

6. Biofortification Applications:
Peroxisomes participate in various biosynthetic pathways. Enhanced understanding of peroxisome dynamics through PEX11B research might open avenues for metabolic engineering to improve nutritional quality of crops.

When considering agricultural applications, it's important to recognize that peroxisome function must be carefully balanced with other cellular processes. Research suggests that simply increasing peroxisome numbers without corresponding adjustments to metabolic pathways may not yield the desired agricultural benefits .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.