Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11D (PEX11D)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Arabidopsis thaliana Peroxisomal Membrane Protein 11D (PEX11D)

Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11D (PEX11D) is a member of the PEX11 protein family, which plays a crucial role in peroxisome proliferation and dynamics in plants. Peroxisomes are vital organelles involved in various metabolic processes, including fatty acid oxidation and the detoxification of reactive oxygen species. The PEX11 family consists of several isoforms, including PEX11A, PEX11B, PEX11C, PEX11D, and PEX11E, each exhibiting distinct functions in peroxisome biogenesis and maintenance.

Role of PEX11D in Peroxisome Dynamics

The primary function of PEX11D is to promote peroxisome proliferation through mechanisms involving membrane elongation and fission. Studies have shown that all members of the PEX11 family contribute to these processes by interacting with other proteins that mediate peroxisome division .

Experimental Findings

  • Overexpression Studies: In Arabidopsis thaliana, overexpression of PEX11D resulted in significant changes to peroxisome morphology, indicating its role as a membrane elongation factor .

  • Gene Expression Analysis: Reduction of PEX11D expression led to decreased peroxisome abundance, highlighting its importance in maintaining peroxisome populations within plant cells .

Comparative Analysis of PEX11 Family Members

ProteinRole in Peroxisome ProliferationComplementation of Yeast Mutants
PEX11AIntegral membrane protein; promotes elongationLimited complementation
PEX11BIntegral membrane protein; less characterizedNot effective
PEX11CIntegral membrane protein; significant elongationStrong complementation
PEX11DIntegral membrane protein; promotes elongationModerate complementation
PEX11EIntegral membrane protein; significant elongationStrong complementation

This table summarizes the roles of different PEX11 proteins in peroxisome dynamics and their ability to complement yeast mutants deficient in peroxisome function.

References

  1. Travis Orth et al., "The PEROXIN11 Protein Family Controls Peroxisome Proliferation in Arabidopsis," The Plant Cell, Volume 19, Issue 1, January 2007.

  2. Sigrun Reumann et al., "PEX11 family members are membrane elongation factors," Journal of Cell Science, 2010.

  3. Lingard et al., "Overexpression of At PEX11 genes induces peroxisome proliferation," Plant Physiology, 2006.

  4. Mathur et al., "High-resolution imaging of peroxisomes," Journal of Cell Science, 2002.

  5. Fan et al., "Fluorescence microscopy analysis of Arabidopsis peroxisomes," Plant Cell, 2005.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and inherent protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX11D; At2g45740; F4I18.28; Peroxisomal membrane protein 11D; Peroxin-11D; AtPEX11d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-236
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PEX11D
Target Protein Sequence
MGTTLDVSRAELALVVMYLNKAEARDKLCRAIQYGSKFLSGGQPGTAQNVDKSTSLARKV FRLFKFVNDLHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERA ELLGRISLFCWMGSSVCTTLVEVGEMGRLSSSMKKIEKGLKNGNKYQDEDYRAKLKKSNE RSLALIKSAMDIVVAAGLLQLAPTKITPRVTGAFGFITSIISCYQLLPTRPKIKTP
Uniprot No.

Target Background

Function

Involved in peroxisomal proliferation. It promotes peroxisomal duplication, aggregation, or elongation without fission.

Gene References Into Functions
  1. Research suggests a model for peroxisome replication where PEX11c, PEX11d, and PEX11e cooperate during the G2 phase to promote peroxisome elongation and recruit FIS1b to the peroxisome membrane. PMID: 18539750
Database Links

KEGG: ath:AT2G45740

STRING: 3702.AT2G45740.1

UniGene: At.12700

Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in developing siliques.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.