Recombinant Arabidopsis thaliana Peroxisomal membrane protein 11E (PEX11E)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please specify this during your order; we will prioritize fulfilling such requests.
Synonyms
PEX11E; PEX11-2; At3g61070; T27I15.160; Peroxisomal membrane protein 11E; Peroxin-11E; AtPEX11e
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PEX11E
Target Protein Sequence
MTTLDLTRAELALIVLYLNKAEARDKICRAIQYGSKFLSGGQPGTAQTVDKNTSLARKVF RLFKFVNDFHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERTE LLGRISLFCWLGSSVCTSAVEIGELGRLSSSMKKMEKELKADDELYRAKLQKSNDRTLAL IKSSMDIIVAIGLLQLAPKTISPRVTGAFGFTTSLISCYQLLPSRPKLKTP
Uniprot No.

Target Background

Function

Involved in peroxisomal proliferation. This protein promotes peroxisomal duplication, aggregation, or elongation without fission.

Database Links

KEGG: ath:AT3G61070

STRING: 3702.AT3G61070.1

UniGene: At.44960

Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in leaves and developing siliques.

Q&A

How is PEX11E classified within the plant PEX11 family?

Arabidopsis thaliana possesses five PEX11 isoforms (PEX11a-e) that can be divided into two phylogenetically distinct groups:

GroupMembersEvolutionary relationship
Group 1PEX11c, PEX11d, PEX11eRelated to Os PEX11-1 and -2 of rice and Le PEX11 of tomato
Group 2PEX11a, PEX11bRelated to Os PEX11-3, -4, and -5

This classification suggests that plant PEX11 genes diversified before the evolutionary split of monocots from dicots . The PEX11c-e group is functionally distinct from PEX11a-b, with different roles in peroxisome morphology and proliferation mechanisms.

PEX11E is also known by several synonyms: PEX11-2, At3g61070, T27I15.160, Peroxin-11E, and AtPEX11e .

What is PEX11E's specific role in peroxisome proliferation?

PEX11E plays a crucial role in peroxisome division and proliferation through multiple mechanisms:

  • It promotes peroxisome duplication without prior elongation, a function that differentiates it from other PEX11 isoforms .

  • It contains a C-terminal dilysine motif that regulates its function; deletion of this motif leads to peroxisome elongation followed by fission, indicating that the intact motif promotes direct fission without elongation .

  • When overexpressed, PEX11E induces peroxisome proliferation, while reduction in its expression decreases peroxisome abundance .

Research has shown that PEX11E can complement to a significant degree the growth phenotype of the Saccharomyces cerevisiae pex11 null mutant on oleic acid, demonstrating functional conservation across species .

How does PEX11E coordinate with other proteins during peroxisome division?

PEX11E coordinates with several proteins in a sequential process of peroxisome division:

  • PEX11E promotes peroxisome membrane elongation and recruits FIS1b (but not FIS1a) to the peroxisome membrane .

  • FIS1b likely then recruits DRP3A (Dynamin-Related Protein 3A) to the peroxisome membrane .

  • DRP3A stimulates the final step of peroxisome division - membrane fission .

This protein interaction network is supported by experimental evidence showing:

InteractionTechniqueObservation
PEX11E-PEX11EYeast two-hybridHomooligomerization occurs between all PEX11 isoforms
PEX11E-FIS1bYeast two-hybridHeterooligomerization with FIS1b, but not with FIS1a or DRP3A
PEX11E-FIS1bCo-expressionFIS1b targets to peroxisomes only when co-expressed with PEX11d or PEX11e

These interactions corroborate models portraying a fission process responsible for the replication of pre-existing peroxisomes during cell cycle-associated constitutive self-replication .

What are the optimal conditions for working with recombinant PEX11E protein?

Recombinant PEX11E protein requires specific handling conditions for optimal experimental results:

ParameterRecommended conditionNotes
Storage-20°C/-80°CAliquoting is necessary for multiple use
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation recommended prior to opening
Cryoprotection5-50% glycerol (final concentration)Default final concentration is 50%
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0Used for storage
StabilityAvoid repeated freeze-thaw cyclesWorking aliquots can be stored at 4°C for up to one week

The recombinant protein is typically produced in E. coli with an N-terminal His tag for purification and provided as a lyophilized powder .

What imaging techniques are most effective for studying PEX11E localization and function?

Several imaging approaches have proven effective for studying PEX11E:

  • Fluorescence microscopy with fusion proteins: CFP-PEX11E or GFP-PEX11E constructs can be expressed in plants to visualize peroxisome morphology changes. This approach has successfully demonstrated colocalization with peroxisomal markers like YFP-PTS1 .

  • Biolistic bombardment: This technique allows for rapid expression of tagged PEX11E constructs, with localization to peroxisomes detectable within 2.5 hours post-bombardment .

  • Electron tomography: This high-resolution technique provides detailed visualization of peroxisome tubulation and interaction with other organelles, such as lipid droplets .

  • Co-expression studies: Expressing fluorescently tagged PEX11E alongside other peroxisomal proteins has revealed interactions and recruitment mechanisms. For example, myc-FIS1b colocalizes with catalase within large cytoplasmic structures when co-expressed with untagged PEX11d, distinctly different from the peroxisomes in cells expressing either protein alone .

How can researchers effectively manipulate PEX11E expression for functional studies?

Multiple approaches have been successfully employed to alter PEX11E expression levels:

  • Overexpression systems: Using the 35S constitutive promoter to drive PEX11E expression in transgenic plants has successfully demonstrated its role in peroxisome proliferation .

  • RNA interference (RNAi): Simultaneous silencing of PEX11c, PEX11d, and PEX11e results in approximately 40% reduction in peroxisome number and dramatic increases in peroxisome size .

  • Complementation assays: Expression of Arabidopsis PEX11E in Saccharomyces cerevisiae pex11 null mutants has been used to assess functional conservation across species .

  • Cell synchronization: Studying PEX11E in synchronized cell cultures has revealed its role in cell cycle-related peroxisome replication, with peroxisomes sequentially enlarging, elongating, and then doubling in number during G2 phase .

How does PEX11E contribute to lipid metabolism and lipid droplet interactions?

Recent research has uncovered PEX11E's critical role in lipid metabolism:

  • PEX11E-marked peroxisomes form tubules that interact with lipid droplets (LDs) during seed germination, a critical process for mobilizing stored lipids .

  • The plant-unique endosomal sorting complex required for transport (ESCRT) component FREE1 interacts directly with both PEX11e and the lipase SDP1 .

  • This interaction regulates peroxisomal tubulation and trafficking of SDP1 to lipid droplets, which is essential for triacylglycerol (TAG) hydrolysis .

Electron tomography analysis has revealed that in wild-type plants, peroxisomes form tubules to engulf LDs, while this process is impaired in free1 mutants . This suggests that PEX11E-mediated peroxisome extensions serve as a physical bridge to lipid droplets, facilitating lipid transfer and metabolism.

What is known about the regulation of PEX11E expression during plant development?

PEX11E expression is regulated in a developmentally and environmentally responsive manner:

  • Unlike PEX11a, which is expressed primarily in developing siliques, PEX11E transcripts are found in multiple Arabidopsis plant tissues and in cells in suspension culture .

  • During the cell cycle, particularly during G2 phase, peroxisomes sequentially enlarge, elongate, and then double in number, which correlates with peaks in PEX11 expression .

  • While specific light regulation of PEX11E has not been thoroughly documented, related family member PEX11b is regulated by light through the far-red light receptor phytochrome A (phyA) and the bZIP transcription factor HYH HOMOLOG (HYH) .

This suggests potential avenues for research into whether PEX11E might be similarly regulated through light-responsive signaling pathways.

How do the functions of different Arabidopsis PEX11 isoforms compare?

The five Arabidopsis PEX11 isoforms have distinct yet overlapping roles in peroxisome dynamics:

IsoformPrimary effect on peroxisomesSpecific characteristics
PEX11aDuplicationPeroxisomes elongate prior to duplication; N-terminus faces cytosol, C-terminus faces matrix
PEX11bAggregationCauses peroxisomes to become aggregated and rounded
PEX11cElongation without fissionContains C-terminal dilysine motif; doesn't promote division
PEX11dElongation without fissionContains C-terminal dilysine motif; doesn't promote division
PEX11eDuplication without prior elongationContains C-terminal dilysine motif that promotes fission without elongation

All five PEX11 isoforms sort directly to peroxisomal membranes, but they have distinct effects on peroxisome morphology and division .

What evolutionary insights can be gained from PEX11E's conservation across species?

PEX11E demonstrates remarkable evolutionary conservation and functional specialization:

  • The membrane tubulation function of PEX11 proteins appears to be evolutionarily conserved across eukaryotes, from yeast to plants and humans .

  • Ectopic expression of PEX11 proteins from different species leads to the formation of juxtaposed elongated peroxisomes (JEPs), indicating a conserved function in membrane reorganization .

  • While functionally conserved, the PEX11 family has undergone significant diversification in plants, with the five Arabidopsis isoforms divided into two distinct phylogenetic groups that diverged before the evolutionary split of monocots from dicots .

  • PEX11E can complement the growth phenotype of the Saccharomyces cerevisiae pex11 null mutant on oleic acid, demonstrating functional conservation across distant species .

This evolutionary conservation highlights the fundamental importance of peroxisome division mechanisms across eukaryotic life.

What are the main challenges in studying PEX11E function and interactions?

Several methodological and conceptual challenges exist in PEX11E research:

  • Functional redundancy: Overlapping functions among the five PEX11 isoforms complicate the interpretation of single-gene manipulation experiments .

  • Temporal dynamics: The rapid changes in peroxisome morphology during the cell cycle require sophisticated time-lapse imaging approaches to fully characterize .

  • Protein-protein interactions: The interactions between PEX11E and other proteins are complex and context-dependent, with different binding partners at different stages of peroxisome division .

  • Integration with cellular metabolism: Understanding how PEX11E-mediated peroxisome dynamics integrate with broader metabolic pathways remains challenging .

What promising future research directions might advance our understanding of PEX11E?

Several promising research directions could significantly advance PEX11E knowledge:

  • Structural biology approaches: Determining the three-dimensional structure of PEX11E, particularly its membrane-interacting domains, would provide insights into its membrane remodeling mechanisms.

  • Quantitative proteomics: Identifying the complete interactome of PEX11E under different developmental and stress conditions would clarify its regulatory networks.

  • Synthetic biology applications: Engineering PEX11E variants with enhanced or modified functions could provide tools for manipulating peroxisome abundance in biotechnology applications.

  • Systems biology integration: Developing computational models that integrate PEX11E-mediated peroxisome dynamics with whole-cell metabolism would advance our understanding of peroxisome function in plant physiology.

  • Stress response studies: Investigating how PEX11E expression and activity change under various biotic and abiotic stresses could reveal new roles in plant adaptation mechanisms.

The continued investigation of PEX11E will not only advance our fundamental understanding of peroxisome biology but may also provide applications in metabolic engineering and crop improvement.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.