Recombinant Arabidopsis thaliana Peroxisome biogenesis protein 16 (PEX16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
PEX16; SSE1; At2g45690; F17K2.22; Peroxisome biogenesis protein 16; Peroxin-16; AtPEX16; AtPex16p; Protein SHRUNKEN SEED 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PEX16
Target Protein Sequence
MEAYKQWVWRNREYVQSFGSFANGLTWLLPEKFSASEIGPEAVTAFLGIFSTINEHIIEN APTPRGHVGSSGNDPSLSYPLLIAILKDLETVVEVAAEHFYGDKKWNYIILTEAMKAVIR LALFRNSGYKMLLQGGETPNEEKDSNQSESQNRAGNSGRNLGPHGLGNQNHHNPWNLEGR AMSALSSFGQNARTTTSSTPGWSRRIQHQQAVIEPPMIKERRRTMSELLTEKGVNGALFA IGEVLYITRPLIYVLFIRKYGVRSWIPWAISLSVDTLGMGLLANSKWWGEKSKQVHFSGP EKDELRRRKLIWALYLMRDPFFTKYTRQKLESSQKKLELIPLIGFLTEKIVELLEGAQSR YTYISGS
Uniprot No.

Target Background

Function
Plays a role in the formation of peroxisomes, lipid bodies, and protein bodies.
Gene References Into Functions
  1. AtPex16p (SSE1), the only known authentic plant peroxin homolog, is found within both peroxisomes and the endoplasmic reticulum (ER) at steady state. This indicates multifunctional roles, particularly ER-related functions, in organelle biogenesis. PMID: 16040658
  2. This study discusses the mechanism of PEX16 protein trafficking from the ER to pre-existing peroxisomes. PMID: 17431024
Database Links

KEGG: ath:AT2G45690

STRING: 3702.AT2G45690.1

UniGene: At.11245

Protein Families
Peroxin-16 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in roots, siliques, seeds, cotyledons, leaves and flowers. Low expression in leaves and roots.

Q&A

What is the function of PEX16 in Arabidopsis thaliana?

AtPEX16 (also known as SSE1) serves multiple essential functions in Arabidopsis:

  • It is involved in peroxisome biogenesis, particularly in the de novo formation of peroxisomes from the endoplasmic reticulum (ER)

  • It contributes to peroxisomal membrane protein targeting

  • It plays a role in fatty acid β-oxidation and lipid metabolism

  • It is essential for the timely degradation of peroxisomal matrix proteins during seedling development

The complete knockout of AtPEX16 (sse1 mutation) is lethal, resulting in shrunken seeds, demonstrating its essential nature for plant viability .

How does AtPEX16 localization differ from other peroxins?

AtPEX16 has a unique dual localization pattern:

  • It is the only known plant peroxin that coexists at steady state in both peroxisomes and the endoplasmic reticulum (ER)

  • It is inserted co-translationally into the ER before trafficking to peroxisomes

  • Immunofluorescence microscopy with antigen affinity-purified IgGs has confirmed this dual localization in suspension cells, roots, and leaf cells

  • Cell fractionation experiments identified two immunorelated polypeptides (42 kDa and 52 kDa) in both peroxisomes and rough ER vesicles

This dual localization supports the model that AtPEX16 has multifunctional roles in both organelle biogenesis and membrane protein targeting.

What protein characteristics does AtPEX16 possess?

FeatureDescription
Full Length367 amino acids
Molecular WeightExpected 41.6 kDa (observed 42 kDa primary band and 52 kDa secondary band)
DomainsPEX16 domain, predicted transmembrane domains
Membrane AssociationPeripherally associated with both peroxisome and ER membranes
TopologyMostly on the matrix side of peroxisomal membranes and mostly on the cytosolic side of ER membranes
Amino Acid SequenceMEAYKQWVWRNREYVQSFGSFANGLTWLLPEKFSASEIGPEAVTAFLGIFSTINEHIIEN APTPRGHVGSSGNDPSLSYPLLIAILKDLETVVEVAAEHFYGDKKWNYIILTEAMKAVIR LALFRNSGYKMLLQGGETPNEEKDSNQSESQNRAGNSGRNLGPHGLGNQNHHNPWNLEGR AMSALSSFGQNARTTTSSTPGWSRRIQHQQAVIEPPMIKERRRTMSELLTEKGVNGALFA IGEVLYITRPLIYVLFIRKYGVRSWIPWAISLSVDTLGMGLLANSKWWGEKSKQVHFSGP EKDELRRRKLIWALYLMRDPFFTKYTRQKLESSQKKLELIPLIGFLTEKIVELLEGAQSR YTYISGS

What phenotypes are observed in Arabidopsis pex16 mutants?

Several types of pex16 mutants have been characterized:

Lethal mutant:

  • The shrunken seed1 (sse1) mutant is inviable with shrunken seeds

  • Peroxisomally-targeted reporters display diffuse localization in sse1 embryos

  • sse1 pollen grains show diffuse localization and enlarged puncta

Viable mutants:

  • pex16-1 and pex16-2 are hypomorphic alleles with dramatically reduced PEX16 protein levels

  • Both show impaired peroxisome function including:

    • Slowed consumption of stored oil bodies

    • Decreased import of matrix proteins

    • Increased peroxisome size

    • Delayed peroxisomal matrix protein degradation

Specific allele phenotypes:

  • pex16-1:

    • Displays hypocotyl elongation defects when grown without sucrose in the dark

    • Shows resistance to growth inhibition by IBA and 2,4-DB

    • Can be complemented by wild-type PEX16 expression

  • pex16-2:

    • Shows milder phenotypes without marked growth defects

    • Lacks resistance to IBA or 2,4-DB

    • Still exhibits oil body persistence, indicating inefficient lipid metabolism

How can viable pex16 mutants be used to study PEX16 function?

Viable pex16 mutants provide valuable research tools:

  • Domain function analysis: Since pex16-1 and pex16-2 affect different regions of the PEX16 gene, comparing their phenotypes helps assess the importance of different PEX16 domains

  • Post-embryonic function studies: Unlike the lethal sse1 mutant, viable alleles allow investigation of PEX16 roles throughout plant development

  • Genetic interaction studies: These mutants can be combined with other pex mutants to reveal functional relationships among peroxins (e.g., synthetic lethal or suppressive interactions)

  • Metabolic analyses: The mutants enable detailed study of PEX16's role in:

    • Fatty acid β-oxidation

    • Lipid metabolism

    • Hormone processing

    • Peroxisomal protein import and turnover

What techniques can be used to visualize AtPEX16 localization?

Researchers have successfully employed multiple complementary approaches:

Immunofluorescence microscopy:

  • Using antigen affinity-purified IgGs against the first 237 amino acids of PEX16

  • An on-slide procedure for detecting low-abundance membrane proteins

  • Co-localization with peroxisomal markers like catalase

Fluorescent protein fusions:

  • GFP::AtPEX16 fusions in transgenic plants

  • Co-localization with RFP-PTS1 as a peroxisomal marker

  • Dual visualization of PEX16 in both peroxisomes and ER

Cell fractionation and biochemical techniques:

  • Sucrose gradient purification of organelles

  • Isopycnic separation of peroxisomes

  • Mg²⁺-shifted isolation of rough ER vesicles

  • Western blotting with PEX16-specific antibodies

Important considerations:

  • PEX16 is a low-abundance protein requiring sensitive detection methods

  • Modified protocols may be needed compared to other peroxisomal proteins

  • At least 150 μg protein per gel well is needed to detect AtPEX16 on immunoblots

How can recombinant AtPEX16 be expressed and purified?

Based on established protocols for recombinant AtPEX16:

Expression system:

  • E. coli is the preferred system for full-length AtPEX16 expression

  • Fusion with an N-terminal His-tag facilitates purification

Protein specifications:

  • Full-length protein (1-367 amino acids)

  • His-tagged for affinity purification

  • Final form: Lyophilized powder

Storage and handling recommendations:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use

  • Avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Working aliquots can be stored at 4°C for up to one week

What experimental approaches can effectively study the dual-membrane topology of AtPEX16?

Studying the complex topology of AtPEX16 requires specialized approaches:

Membrane association analysis:

  • Sequential extraction with increasing detergent concentrations

  • Carbonate extraction to distinguish integral vs. peripheral membrane proteins

  • Temperature-induced phase separation in Triton X-114

Topology determination:

  • Protease protection assays with intact organelles

  • Selective permeabilization of membranes with detergents

  • Detection of protected domains using domain-specific antibodies

For dual localization studies:

  • Density gradient fractionation separating ER and peroxisomal fractions

  • Immunogold electron microscopy for precise subcellular localization

  • Differential centrifugation to isolate organelle subpopulations

Findings from these approaches:

  • AtPEX16 is peripherally associated with both peroxisome and ER membranes

  • It primarily faces the peroxisomal matrix in peroxisomes

  • It primarily faces the cytosol when in the ER membrane

  • Two immunorelated polypeptides (42 kD and 52 kD) are found in both organelles

Comparative Biology and Evolution

While research on AtPEX16 protein interactions is still developing, several key relationships have been established:

Confirmed interactions:

  • AtPEX16 partially complements Yarrowia pex16 mutants, indicating functional conservation

  • PEX16 works in coordination with PEX3 and PEX19 in peroxisome membrane protein insertion

  • These three peroxins (PEX3, PEX16, PEX19) are considered the core machinery for early peroxisome biogenesis

Genetic interactions in Arabidopsis:

  • When combined with other pex mutants, pex16 alleles can show:

    • Worsened phenotypes (synthetic enhancement)

    • Improved peroxisome function (genetic suppression)

  • These interactions provide insight into the functional relationships between peroxins

In other systems:

  • In fungi like Metarhizium robertsii, PEX16 works downstream of regulatory factors like ASH1 (histone methyltransferase)

  • In humans and other mammals, PEX16 recruits PEX3 to the ER for subsequent PEX19-dependent peroxisomal membrane protein insertion

How does AtPEX16 contribute to peroxisomal matrix protein import?

AtPEX16's role in matrix protein import involves both direct and indirect mechanisms:

Direct evidence of import defects:

  • pex16 mutants show decreased import of matrix proteins

  • Peroxisomally-targeted fluorescent proteins display diffuse localization in pex16 mutants

  • Matrix proteins with PTS1 signals are mislocalized in severe pex16 mutants

Mechanistic contributions:

  • AtPEX16 is necessary for proper assembly of the peroxisomal membrane import machinery

  • By facilitating peroxisomal membrane protein insertion, PEX16 indirectly enables matrix protein import

  • The enlarged peroxisomes in pex16 mutants suggest defects in both import and fission processes

Connection to metabolic defects:

  • The import defects in pex16 mutants correlate with:

    • Reduced β-oxidation capacity

    • Impaired metabolism of IBA and 2,4-DB

    • Delayed degradation of peroxisomal matrix enzymes like isocitrate lyase (ICL) and malate synthase (MLS)

What is the relationship between AtPEX16 and oil body utilization in plants?

AtPEX16 plays a crucial role in the metabolism of stored lipids:

Experimental evidence:

  • Both pex16-1 and pex16-2 mutants show persistence of oil bodies in 6-day-old seedlings, whereas wild-type seedlings consume these stores by day 4

  • pex16-1 displays hypocotyl elongation defects when grown without sucrose in the dark, indicating impaired energy mobilization from stored lipids

  • Expressing wild-type PEX16 in the mutants restores oil body utilization

Mechanistic explanation:

  • Peroxisomes are essential for fatty acid β-oxidation

  • Through β-oxidation, fatty acids derived from triacylglycerols in oil bodies are catabolized to acetyl-CoA

  • This acetyl-CoA fuels seedling growth until photosynthesis is established

  • PEX16 is required for functional peroxisomes that can perform β-oxidation

Broader significance:

  • This function is particularly important during seedling establishment when stored lipids provide the primary energy source

  • The connection between PEX16 and oil body utilization underscores the critical role of peroxisomes in plant energy metabolism

  • Similar mechanisms exist in fungi, where peroxisomal fatty acid degradation promotes lipolysis and prevents lipotoxicity

What experimental approaches can address contradictions in the literature regarding PEX16 function?

Several approaches can help resolve apparent contradictions in PEX16 function across studies:

Complementation across species:

  • Express AtPEX16 in yeast, human, or other pex16 mutants

  • Assess which functions are rescued and which are not

  • This approach has already shown that Arabidopsis PEX16 partially complements Yarrowia pex16 mutants

Domain swap experiments:

  • Create chimeric PEX16 proteins with domains from different species

  • Identify which domains confer species-specific functions

  • Test complementation of various pex16 mutants with these chimeras

Tissue-specific and developmental analyses:

  • PEX16 levels decline as wild-type seedlings mature, suggesting developmental regulation

  • Study PEX16 function in different tissues and developmental stages

  • Use inducible expression systems to control timing of PEX16 expression

Multi-omics approaches:

  • Compare transcriptomes, proteomes, and metabolomes of different pex16 mutants

  • Identify compensatory mechanisms that might explain phenotypic differences

  • Correlate molecular changes with observed phenotypes

Advanced imaging:

  • Use super-resolution microscopy to visualize PEX16 distribution in different membranes

  • Track PEX16 trafficking in real-time using photoactivatable fluorescent proteins

  • Examine interactions between PEX16 and other peroxins using techniques like FRET or BiFC

These approaches can help develop a unified model of PEX16 function that accounts for the observed differences across species and experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.