Recombinant Arabidopsis thaliana Peroxisome biogenesis protein 3-2 (PEX3-2)

Shipped with Ice Packs
In Stock

Description

General Information

Arabidopsis thaliana is a model organism often used in plant research to study peroxisomes . Peroxisomes are organelles within plant cells that perform various metabolic functions, including fatty acid β-oxidation .

PEX3 is a gene responsible for peroxisome membrane assembly . Deletion of PEX32 results in a strong reduction of peroxisome numbers .

Function and Role

PEX3-2, like other PEX proteins, plays a crucial role in the biogenesis of peroxisomes . Specifically, PEX3-2 is involved in the following:

  • Peroxisome biogenesis PEX3 is essential for the assembly of the peroxisome membrane. Mutation of the PEX3 gene inactivates its function, leading to the failure of peroxisomes to form .

  • Protein import PEX proteins are involved in regulating peroxisomal protein import .

  • Tethering peroxisomes to the ER Pex24 and Pex32 are required to tether peroxisomes to the ER for inheritance .

Research Findings

Research has provided insights into the function and interactions of PEX3-2:

  • A study utilizing genome-wide association analysis identified PEX3 as a susceptibility factor in Arabidopsis thaliana when challenged with the Ralstonia solanacearum pathogen . This suggests that PEX3 may play a role in plant defense responses .

  • In Hansenula polymorpha, Pex11 levels were strongly reduced in pex32 cells . Overexpression of PEX11 did not increase Pex11 levels in pex32 cells, and cells still showed mislocalization of GFP-SKL to the cytosol, similar to the pex32 control .

  • The ER protein Pex32 is required for associating peroxisomes to the ER .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its development.
Synonyms
PEX3-2; At1g48635; F11I4.17; F9P7.1; Peroxisome biogenesis protein 3-2; Peroxin-3-2; AtPEX3-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-364
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PEX3-2
Target Protein Sequence
MDFVRGFWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAHERENDEIIKTQM KAHFESIQMIVDSTTLPHAMQFLSIRISEEIDVSHVMDRLNQGKGMLSPPEKLQLWDELK ILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHLLEEVDLIDRDDEQKF LSSADFLVTNAMPSLISDMQGSAEEVLKGKQLKDVITTRVLQETVMQIVDVFMSTGSPHH WVDYLMMPQDTKLSRTTSDSSDEAVSKFHQLMVETREVLISTEFTNIVEISLKCFTDVLV EEMETQTEAGGLATGKPLAKVLPQIEKTMNVITAEPSKNRFLQIIRDLPEVKLFFTLLYA NMPQ
Uniprot No.

Target Background

Function

Recombinant Arabidopsis thaliana Peroxisome biogenesis protein 3-2 (PEX3-2) is involved in peroxisome morphology determination, but not in the import of peroxisomal matrix proteins. It may function as a docking factor for PEX19, playing a crucial role in the import of peroxisomal membrane proteins into peroxisomes.

Database Links

KEGG: ath:AT1G48635

UniGene: At.18897

Protein Families
Peroxin-3 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is the molecular structure and characterization of PEX3-2 in Arabidopsis thaliana?

PEX3-2 (Q8S9K7) is a full-length protein consisting of 364 amino acids that functions as a peroxisome biogenesis factor in Arabidopsis thaliana. The protein contains specific structural domains that facilitate its role in peroxisome membrane formation. When expressed recombinantly, the protein typically includes a His-tag to facilitate purification and detection. The amino acid sequence of PEX3-2 is: MDFVRGFWRKHRRKVLVTAGCLGSGYLLYKLYNSHTRRLADLERELAHERENDEIIKTQMKAHFESIQMIVDSTTLPHAMQFLSIRISEEIDVSHVMDRLNQGKGMLSPPEKLQLWDELKILSFTRMVLSLWSVTMLSLYIRVQVNILGRHLYVDTARALGSSHLLEEVDLIDRDDEQKFLSSADFLVTNAMPSLISDMQGSAEEVLKGKQLKDVITTRVLQETVMQIVDVFMSTGSPHHWVDYLMMPQDTKLSRTTSDSSDEAVSKFHQLMVETREVLISTEFTNIVEISLKCFTDVLVEEMETQTEAGGLATGKPLAKVLPQIEKTMNVITAEPSKNRFLQIIRDLPEVKLFFTLLYANMPQ .

How should recombinant PEX3-2 be properly stored and handled in laboratory settings?

For optimal stability and activity of recombinant PEX3-2, the lyophilized protein should be stored at -20°C to -80°C upon receipt. Aliquoting is necessary for multiple use to avoid protein degradation from repeated freeze-thaw cycles. When reconstituting the protein, it is recommended to use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To extend storage life, adding glycerol to a final concentration of 5-50% (with 50% being typical) is recommended before aliquoting for long-term storage. Working aliquots may be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided to maintain protein integrity and functionality .

What expression systems are most effective for producing recombinant PEX3-2?

E. coli is the predominantly used expression system for recombinant PEX3-2 production, offering high yields and cost-effectiveness. The methodology typically involves cloning the PEX3-2 gene (At1g48635) into an appropriate expression vector containing a His-tag sequence, followed by transformation into an E. coli strain optimized for protein expression. After induction with IPTG, cells are harvested, lysed, and the protein is purified using affinity chromatography. This approach yields recombinant protein with greater than 90% purity as determined by SDS-PAGE. When designing expression constructs, researchers should consider that the full-length protein (1-364 amino acids) includes membrane-spanning regions that may affect solubility, potentially requiring optimization of expression conditions or the use of detergents during purification .

How does PEX3-2 contribute to plant susceptibility to pathogens like Ralstonia solanacearum?

Recent genome-wide association studies have identified PEX3 as a susceptibility factor in Arabidopsis thaliana's response to Ralstonia solanacearum infection. The research demonstrated that PEX3 is one of several genes underlying quantitative trait loci (QTLs) associated with plant response to the hpaP mutant of R. solanacearum. Functional validation through reverse genetics confirmed PEX3 as a susceptibility factor, indicating its involvement in processes that influence plant-pathogen interactions .

The mechanism appears to involve specific biological processes that are important for R. solanacearum virulence. When HpaP, a key pathogenicity regulator in R. solanacearum, is mutated, plants show a delayed susceptibility response compared to wild-type bacterial infection. This suggests that PEX3-2 may be directly or indirectly targeted by the pathogen's virulence system, potentially through interactions with type III secretion system effectors that manipulate host cellular processes to promote infection .

What are the functional relationships between PEX3-2 and other peroxisomal proteins in Arabidopsis?

PEX3-2 functions within a complex network of peroxisomal proteins in Arabidopsis thaliana. While PEX3-2 is involved in peroxisome biogenesis, it operates alongside numerous other PTS2 (Peroxisomal Targeting Signal 2) proteins. Research indicates that Arabidopsis contains 19 PTS2 proteins belonging to various protein families, forming a complex peroxisomal proteome .

The interactions between PEX3-2 and other peroxisomal proteins, particularly PEX19, appear to be crucial for its function. Structural analysis suggests that the predicted α-helical region within the first 56 amino acid residues of PEX19 may interact with PEX3, though the specific interaction with PEX3-2 requires further experimental validation . Understanding these interactions provides insight into how PEX3-2 contributes to peroxisome membrane formation and maintenance within the broader context of peroxisome biogenesis and function.

What methodological approaches are recommended for studying PEX3-2 mutants?

To effectively study PEX3-2 mutants in Arabidopsis thaliana, researchers should implement a multi-faceted approach:

  • Generation of mutants: CRISPR-Cas9 gene editing or T-DNA insertion lines are recommended approaches. For point mutations, site-directed mutagenesis of specific conserved residues identified through sequence alignment across species can provide valuable insights into structure-function relationships.

  • Phenotypic analysis: Comprehensive phenotyping should include:

    • Microscopic analysis of peroxisome morphology and distribution using fluorescent protein fusions

    • Assessment of peroxisome-dependent metabolic pathways (fatty acid β-oxidation, photorespiration)

    • Evaluation of pathogen susceptibility using standardized infection assays with R. solanacearum

  • Complementation studies: To confirm that observed phenotypes are due to PEX3-2 disruption, expressing the wild-type PEX3-2 gene in mutant backgrounds should rescue mutant phenotypes. Using the recombinant protein (Q8S9K7) for in vitro complementation assays can provide mechanistic insights when combined with cellular studies .

  • Protein interaction analysis: Yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation assays can identify protein partners, particularly focusing on potential interactions with PEX19 and other peroxisome biogenesis factors.

How can recombinant PEX3-2 be utilized in protein-protein interaction studies?

For rigorous protein-protein interaction studies involving recombinant PEX3-2, multiple complementary approaches should be employed:

  • Pull-down assays: The His-tagged recombinant PEX3-2 can be immobilized on Ni-NTA resin and used to capture interacting proteins from plant cell lysates. Bound proteins can then be identified by mass spectrometry.

  • Surface Plasmon Resonance (SPR): This technique allows real-time, label-free measurement of binding kinetics between the purified recombinant PEX3-2 and potential interacting partners, providing quantitative binding parameters (KD, kon, koff).

  • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of interactions, ITC provides valuable data on binding enthalpies and entropies, complementing kinetic data from SPR.

  • Crosslinking studies: Chemical crosslinking of the recombinant protein with potential interactors followed by mass spectrometric analysis can identify interaction interfaces and provide structural insights.

When working with recombinant PEX3-2, researchers should consider that the protein's natural membrane association may affect interaction studies, potentially requiring detergent optimization or the use of membrane mimetics like nanodiscs or liposomes to maintain native-like conformations during interaction studies .

What are the optimal purification strategies for recombinant PEX3-2?

The optimal purification strategy for recombinant His-tagged PEX3-2 involves a multi-step approach:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification step, exploiting the His-tag's affinity for nickel ions.

  • Intermediate purification: Size exclusion chromatography (SEC) to separate the protein of interest from aggregates and to confirm its oligomeric state.

  • Polishing: Ion exchange chromatography may be employed as a final step to achieve >95% purity if required for crystallization studies.

During purification, buffer optimization is critical due to PEX3-2's membrane-associated nature. Recommended buffers include Tris/PBS-based systems at pH 8.0 with 6% trehalose as a stabilizing agent . For maintaining protein solubility, low concentrations of mild detergents (0.01-0.05% DDM or 0.5-1% CHAPS) may be beneficial during extraction and early purification steps, followed by detergent removal for applications sensitive to their presence.

How should researchers design experiments to study PEX3-2's role in pathogen susceptibility?

When investigating PEX3-2's role in pathogen susceptibility, particularly to Ralstonia solanacearum, a comprehensive experimental design should include:

Experimental ApproachMethodologyExpected OutcomesControls
Genetic manipulationGenerate PEX3-2 knockout, knockdown, and overexpression linesAltered susceptibility to R. solanacearumWild-type and empty vector transformants
Pathogen challenge assaysStandard root inoculation with R. solanacearum wild-type and hpaP mutant strainsQuantitative disease progression dataMock inoculation; known resistant/susceptible genotypes
TranscriptomicsRNA-Seq of infected vs. uninfected plants at different timepointsIdentification of co-regulated gene networksNon-infected tissue; time-matched samples
Protein localizationFluorescent protein fusions observed during infectionChanges in PEX3-2 localization during pathogenesisFree fluorescent protein controls; uninfected controls
Biochemical interactionCo-IP or BiFC between PEX3-2 and bacterial effectorsDirect evidence of pathogen targetingNegative interaction controls; known interactors

This experimental framework allows for rigorous testing of the hypothesis that PEX3-2 functions as a susceptibility factor by being targeted by R. solanacearum effectors, potentially through the HpaP-regulated type III secretion system. Quantification of bacterial growth, plant symptom development, and molecular responses are essential for comprehensive characterization .

What techniques are most effective for characterizing the structural features of PEX3-2?

For comprehensive structural characterization of recombinant PEX3-2, researchers should employ multiple complementary techniques:

When working with the recombinant His-tagged PEX3-2, researchers should consider that the protein's predicted α-helical regions, particularly those involved in potential PEX19 binding, may be critical structural features to preserve during purification and analysis .

How does Arabidopsis thaliana PEX3-2 compare to homologs in other plant species?

Comparative analysis of PEX3-2 across plant species reveals important evolutionary insights and functional conservation. When examining peroxisomal proteins between Arabidopsis thaliana and Solanum lycopersicum (tomato), researchers have observed both conservation and divergence. While Arabidopsis contains 19 PTS2 proteins in total, S. lycopersicum has a reduced number (14), though representatives for each protein family are maintained .

The diversity and versatility of peroxisomal protein domains appear generally reduced in tomato compared to Arabidopsis, suggesting potential evolutionary specialization of peroxisomal functions across plant species. This comparative approach provides valuable context for understanding PEX3-2 function within the broader evolutionary landscape of plant peroxisome biogenesis .

What insights can be gained from studying PEX3-2 in the context of natural variation in Arabidopsis thaliana?

The study of natural variation in Arabidopsis thaliana provides powerful insights into PEX3-2 function, particularly in the context of plant-pathogen interactions. Genome-wide association studies (GWAS) using both worldwide and local Arabidopsis populations have identified PEX3 as a susceptibility factor in response to Ralstonia solanacearum infection .

This approach revealed different genetic architectures in worldwide versus local mapping populations, with a global delayed response to the hpaP mutant compared to the wild-type strain. The identification of quantitative trait loci (QTLs) associated with hpaP mutant inoculation provided candidate genes, including PEX3, that were subsequently validated as susceptibility factors .

This natural variation approach represents an original and powerful strategy to identify genes that are directly or indirectly targeted by pathogens, offering complementary insights to traditional reverse genetics approaches by leveraging the genetic diversity present in natural Arabidopsis populations .

What are the most promising avenues for future research on PEX3-2?

Future research on Arabidopsis thaliana PEX3-2 should focus on several key areas that could significantly advance our understanding of peroxisome biogenesis and plant-pathogen interactions:

  • Structural biology: Determination of the high-resolution structure of PEX3-2, particularly in complex with interaction partners like PEX19, would provide mechanistic insights into peroxisome membrane protein insertion.

  • Systems biology approach: Integration of proteomics, transcriptomics, and metabolomics data to place PEX3-2 within the broader cellular network, particularly during pathogen challenge.

  • Targeted mutagenesis: Creation of a suite of point mutations in conserved residues to identify critical functional domains and to dissect structure-function relationships.

  • Interactome mapping: Comprehensive identification of both protein and lipid interaction partners using proximity labeling approaches like BioID or APEX.

  • Pathogen effector targeting: Investigation of whether PEX3-2 is directly targeted by specific R. solanacearum type III effectors, potentially through the HpaP regulatory pathway, and how this contributes to disease susceptibility.

These research directions would leverage the available recombinant PEX3-2 resources while addressing fundamental questions about peroxisome biogenesis and the manipulation of host processes by pathogens .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.