Recombinant Arabidopsis thaliana Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (At1g61280)

Shipped with Ice Packs
In Stock
Cat. No.
BT2456767
Source
in vitro E.coli expression system
Synonyms
At1g61280; T1F9.23; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Quick Inquiry

Description

General Information

Arabidopsis thaliana, also known as thale cress, is a small flowering plant widely used in plant biology research as a model organism because it was the first plant to have its genome sequenced in 2000 . Arabidopsis thaliana is used as a "Rosetta Stone" for plant biology by researchers globally .

Experimental Evidence

Experiment TypeDetailsResults
Overexpression in Escherichia coliAT1G78690 was overexpressed in E. coli, and the accumulating glycerophospholipids were extracted .Electrospray ionization quadrupole time-of-flight mass spectrometry (ESI-MS) identified acylphosphatidylglycerol (acyl-PG) rather than N-acylphosphatidylethanolamine (N-acyl-PE) .
In vitro enzyme assaysAssays using $$^{32}$$P- and $$^{14}$$C-radiolabeled substrates were performed .AT1G78690 acylated 1-acyllysophosphatidylethanolamine (1-acyllyso-PE) and 1-acyllysophosphatidylglycerol (1-acyllyso-PG) but not phosphatidylethanolamine (PE) or phosphatidylglycerol (PG) .
Lipid analysis after acylationThe diacylated product formed by AT1G78690 was analyzed using base hydrolysis, phospholipase D treatment, ESI-MS, and MS/MS .AT1G78690 acylated the sn-2-position of 1-acyllyso-PE and 1-acyllyso-PG .

Role in Stress Response

Research indicates that several genes in Arabidopsis thaliana play roles in response to environmental stresses, such as heavy metal exposure . For example, EXTENSIN18 (EXT18) and TLC (TRAM-LAG1-CLN8) are key genes for differential lead (Pb) accumulation and tolerance in natural Arabidopsis thaliana accessions . These genes are involved in cell wall thickening and vacuolar sequestration, mechanisms that minimize Pb toxicity . Although At1g61280 is not directly mentioned in this context, understanding the function of related proteins involved in lipid metabolism could provide insights into stress response pathways.

Post-Translational Modifications

Arabinogalactan-peptides (AGPs) in Arabidopsis thaliana undergo post-translational modifications, including glycosylation and glycosylphosphatidylinositol (GPI) anchor addition . These modifications are crucial for protein function and localization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
At1g61280; T1F9.23; Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
At1g61280
Target Protein Sequence
MLSLNQEVHGPKTSEVYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAM PMYSMVTLLVALVFYIGLNFMSTSKPTSLNTLFDDYSREDVNFLPLMKNGEDRPIDPISD IDITRINDLMFDSHLAK
Uniprot No.
O64792

Target Background

Function
This protein is a subunit of the complex that catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, representing the initial step in GPI biosynthesis.
Database Links

KEGG: ath:AT1G61280

STRING: 3702.AT1G61280.1

UniGene: At.52300

Protein Families
PIGP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.