Recombinant Arabidopsis thaliana Photosystem I reaction center subunit III, chloroplastic (PSAF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PSAF; At1g31330; T19E23.12; Photosystem I reaction center subunit III, chloroplastic; Light-harvesting complex I 17 kDa protein; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
68-221
Protein Length
Full Length of Mature Protein
Species
Arabidopsis thaliana (Mouse-ear cress)
Target Names
PSAF
Target Protein Sequence
DISGLTPCKDSKQFAKREKQQIKKLESSLKLYAPESAPALALNAQIEKTKRRFDNYGKYG LLCGSDGLPHLIVNGDQRHWGEFITPGILFLYIAGWIGWVGRSYLIAISGEKKPAMKEII IDVPLASRIIFRGFIWPVAAYREFLNGDLIAKDV
Uniprot No.

Target Background

Function
This protein participates in efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). It functions as a plastocyanin-docking protein, facilitating the specific binding of plastocyanin to Photosystem I.
Database Links

KEGG: ath:AT1G31330

STRING: 3702.AT1G31330.1

UniGene: At.47610

Protein Families
PsaF family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein; Lumenal side.

Q&A

What is the structural role of PSAF in the Arabidopsis thaliana Photosystem I complex?

PSAF (Photosystem I reaction center subunit III) is an essential component of the PSI complex that contributes to the stability and assembly of the PSI-LHCI supercomplex in Arabidopsis thaliana. The protein is located on the luminal side of the thylakoid membrane and plays a crucial role in mediating interactions between the PSI core and light-harvesting complexes . Recent cryo-EM studies have revealed that PSAF forms specific contacts with other PSI subunits, helping to maintain the structural integrity of the entire complex. The protein contains transmembrane domains that anchor it to the thylakoid membrane, while its luminal domains participate in protein-protein interactions essential for PSI assembly and function .

Methodology for structural analysis typically involves:

  • Isolation of PSI-LHCI supercomplexes from Arabidopsis thylakoids

  • Cryo-electron microscopy of the purified complexes

  • 3D reconstruction and model building

  • Validation through biochemical and biophysical approaches

What are the amino acid sequence characteristics of Arabidopsis PSAF and how do they compare to other species?

The Arabidopsis thaliana PSAF protein is characterized by a specific sequence that contains conserved domains typical of PSI subunit III proteins. Based on the available sequence data, PSAF contains regions that facilitate its interaction with other PSI components, particularly with light-harvesting complexes . The protein contains both hydrophobic transmembrane regions and hydrophilic domains that participate in various structural and functional interactions within the photosystem.

Comparative sequence analysis shows that PSAF is highly conserved among higher plants, with significant sequence homology between Arabidopsis and other plant species. This conservation reflects the essential role of PSAF in PSI function across the plant kingdom. Specifically, key residues involved in protein-protein interactions and cofactor binding are particularly well conserved, while regions facing the lipid bilayer or stromal space may show greater variability .

How does PSAF contribute to the energy transfer process in Photosystem I?

PSAF contributes significantly to energy transfer processes in Photosystem I by facilitating proper positioning of chlorophyll molecules and mediating interactions with light-harvesting complexes. Research has shown that PSAF helps optimize the excitation energy transfer from the peripheral antenna system to the PSI reaction center . The protein's specific structural arrangement ensures efficient harvesting of light energy and subsequent electron transfer.

The energy transfer process involving PSAF includes:

  • Capture of light energy by chlorophyll molecules in the light-harvesting complexes

  • Transfer of excitation energy to the PSI core complex

  • Channeling of electrons through the electron transport chain

  • Efficient reduction of ferredoxin on the stromal side of PSI

Recent studies using time-resolved spectroscopy have demonstrated that alterations in PSAF can significantly affect the efficiency of energy transfer within PSI, underlining its importance in maintaining optimal photosynthetic performance .

What are the most effective expression systems for producing recombinant Arabidopsis PSAF protein?

Recombinant expression of Arabidopsis thaliana PSAF has been successfully achieved using several expression systems, each with specific advantages depending on research objectives. The most effective approaches include:

Bacterial Expression Systems:

  • E. coli BL21(DE3) strain using pET vector systems with appropriate tags (His6, GST)

  • Codon optimization is critical due to differences between plant and bacterial codon usage

  • Expression typically performed at lower temperatures (18-20°C) to improve protein folding

  • Inclusion of chaperones (GroEL/GroES) can enhance proper folding

Plant-Based Expression Systems:

  • Transient expression in Nicotiana benthamiana leaves via Agrobacterium infiltration

  • Stable transformation of Arabidopsis thaliana, particularly useful for complementation studies

  • Chloroplast transformation systems to ensure proper targeting and folding

For functional studies, plant-based expression systems often yield PSAF protein with more native-like properties, while bacterial systems typically provide higher yields for structural and biochemical analyses. Selection of the appropriate expression system should be based on specific experimental requirements and downstream applications .

What purification strategies are most effective for isolating recombinant PSAF while maintaining its native conformation?

Effective purification of recombinant PSAF requires careful consideration of its membrane-associated nature and structural integrity. The following multi-step purification strategy is recommended:

For His-tagged PSAF:

  • Cell lysis under mild conditions (non-ionic detergents like n-dodecyl-β-D-maltoside at 0.5-1%)

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

  • Optional ion exchange chromatography for higher purity

Critical parameters:

  • Maintaining temperature at 4°C throughout purification

  • Including protease inhibitors to prevent degradation

  • Using mild detergents to maintain native conformation

  • Verifying protein quality through circular dichroism spectroscopy and dynamic light scattering

For applications requiring incorporation into liposomes or nanodiscs, additional steps involving gradual detergent removal through dialysis or adsorption may be necessary. Verification of proper folding should be performed using spectroscopic methods and functional assays to ensure the purified protein retains native-like properties .

How can researchers assess the quality and functional integrity of purified recombinant PSAF?

Assessment of recombinant PSAF quality and functional integrity requires a combination of biophysical, biochemical, and functional approaches:

Biophysical Characterization:

  • Circular dichroism spectroscopy to assess secondary structure content

  • Thermal stability analysis using differential scanning calorimetry

  • Dynamic light scattering to evaluate homogeneity and aggregation state

  • Mass spectrometry for accurate mass determination and post-translational modifications

Biochemical Assessment:

  • SDS-PAGE and western blotting with specific antibodies

  • Limited proteolysis to assess proper folding

  • Detergent resistance as an indicator of structural integrity

Functional Verification:

  • Reconstitution with other PSI components to assess complex formation

  • Chlorophyll binding assays to verify pigment-binding capacity

  • Energy transfer measurements using time-resolved fluorescence spectroscopy

  • Ability to form proper protein-protein interactions with other photosystem components

A comprehensive assessment using these complementary approaches ensures that the purified recombinant PSAF protein possesses the structural and functional characteristics necessary for reliable research applications .

How does PSAF interact with other subunits in the Photosystem I complex?

PSAF engages in specific interactions with multiple subunits in the Photosystem I complex, contributing to both structural stability and functional efficiency. Based on recent cryo-EM studies of Arabidopsis PSI-LHCI complexes, PSAF forms critical contacts with:

Core PSI Subunits:

  • PsaA: Forms extensive interactions through multiple contact points on the luminal side

  • PsaB: Interacts via conserved residues that stabilize the core complex

  • PsaL: Forms specific contacts that are critical during state transitions

Light-Harvesting Complex Interactions:

  • LHCI proteins: PSAF mediates the attachment of LHCI complexes to the PSI core

  • Forms specific contacts with Lhca1 and Lhca4 subunits

These interactions are primarily mediated through hydrophobic and electrostatic contacts, as well as hydrogen bonding networks. Notably, the cryo-EM structure of Arabidopsis PSI-LHCI revealed that PSAF undergoes conformational changes during state transitions, particularly when LHCII attaches to PSI in state 2. These dynamic interactions allow for regulation of excitation energy distribution between PSI and PSII in response to changing light conditions .

What is the role of PSAF in electron transfer within Photosystem I?

PSAF plays a significant role in facilitating electron transfer within Photosystem I, particularly in the interaction with soluble electron acceptors. Research has demonstrated that:

  • PSAF contributes to creating the docking site for ferredoxin on the stromal side of PSI

  • It helps position the terminal electron acceptors (FA and FB iron-sulfur clusters) for efficient electron transfer

  • Specific residues in PSAF provide electrostatic interactions that guide ferredoxin binding

The electron transfer pathway involving PSAF typically proceeds from the P700 reaction center through a series of cofactors, ultimately reaching ferredoxin. Time-resolved spectroscopic studies have shown that alterations in PSAF can affect the kinetics of electron transfer to ferredoxin, underscoring its importance in optimizing this process .

Experimental approaches to study PSAF's role in electron transfer include:

  • Flash photolysis combined with absorption spectroscopy

  • Electron paramagnetic resonance (EPR) studies

  • Site-directed mutagenesis of key residues

  • Reconstitution experiments with purified components

These methods have revealed that PSAF contributes to creating the proper electrostatic environment for docking of ferredoxin, thus influencing the efficiency of the entire electron transfer process .

What phenotypes are observed in Arabidopsis mutants lacking or having altered PSAF?

Arabidopsis thaliana mutants with altered or absent PSAF exhibit distinct phenotypes that highlight the protein's essential role in photosynthesis. Studies of these mutants have revealed:

Complete PSAF Knockout Mutants:

  • Severely impaired growth and development

  • Pale green to yellowish leaf coloration

  • Significantly reduced PSI accumulation

  • Unable to grow photoautotrophically, requiring supplemental carbon sources

PSAF Point Mutants:

  • Variable phenotypes depending on the specific mutation

  • Altered excitation energy transfer between light-harvesting complexes and PSI

  • Compromised state transitions

  • Reduced efficiency of electron transfer to ferredoxin

Molecular and Biochemical Characteristics:

  • Destabilization of the PSI-LHCI supercomplex

  • Impaired binding of light-harvesting complexes

  • Altered thylakoid membrane architecture, including reduced grana stacking

  • Accumulation of reactive oxygen species under high light conditions

These phenotypes confirm that PSAF is essential for both the structural integrity and functional efficiency of Photosystem I. The severity of phenotypes correlates with the degree of PSAF impairment, with complete loss typically being lethal under photoautotrophic conditions .

How does PSAF contribute to state transitions in Arabidopsis?

PSAF plays a critical role in facilitating state transitions—the dynamic redistribution of excitation energy between photosystems in response to changing light conditions. Recent cryo-EM studies have revealed that:

PSAF undergoes significant conformational changes during the transition from state 1 to state 2. These changes help accommodate the binding of mobile LHCII trimers to PSI during state 2, when PSII is preferentially excited . The molecular mechanism involves:

  • In state 1 (PSI preferentially excited):

    • PSAF maintains a standard conformation within the PSI-LHCI complex

    • No direct interactions with LHCII trimers are observed

  • In state 2 (PSII preferentially excited):

    • PSAF adopts an altered conformation

    • Forms new contacts with PsaH, PsaL, and PsaO subunits

    • Participates in creating a docking site for phosphorylated LHCII trimers

Experimental approaches to study PSAF's role in state transitions include:

  • Comparative cryo-EM structures of PSI-LHCI in different states

  • Phosphorylation assays to monitor LHCII phosphorylation

  • Time-resolved fluorescence measurements to track energy redistribution

  • Mutational analyses of key residues in PSAF

These studies have shown that PSAF is essential for optimizing the efficiency of light energy utilization under fluctuating light conditions, contributing to photosynthetic flexibility in Arabidopsis .

What methods are most effective for studying PSAF-protein interactions in vitro?

Several complementary methods have proven effective for investigating PSAF interactions with partner proteins in vitro, each offering distinct advantages:

Co-immunoprecipitation (Co-IP):

  • Utilizes antibodies against PSAF or interacting partners

  • Effective for identifying stable interactions

  • Can be used with native or recombinant proteins

  • Best performed with mild detergents to preserve membrane protein interactions

Surface Plasmon Resonance (SPR):

  • Provides real-time kinetic data on association/dissociation rates

  • Requires immobilization of purified PSAF or binding partners

  • Allows determination of binding constants (KD)

  • Especially useful for characterizing interactions with ferredoxin and other soluble proteins

Microscale Thermophoresis (MST):

  • Detects interactions based on changes in thermophoretic mobility

  • Requires minimal sample quantities

  • Works well with membrane proteins in detergent solutions

  • Provides accurate binding affinities

Crosslinking Mass Spectrometry:

  • Identifies precise interaction interfaces

  • Uses chemical crosslinkers followed by mass spectrometric analysis

  • Particularly valuable for mapping transient or dynamic interactions

  • Provides residue-level interaction data

Förster Resonance Energy Transfer (FRET):

  • Monitors protein-protein proximity in real-time

  • Requires fluorescent labeling of interaction partners

  • Can detect dynamic changes in interaction under varying conditions

  • Particularly useful for monitoring PSAF interactions during state transitions

A comprehensive interaction study typically employs multiple complementary techniques to validate findings and obtain both qualitative and quantitative interaction data .

How do post-translational modifications affect PSAF function and interactions?

Post-translational modifications (PTMs) of PSAF significantly influence its functional properties and interactions within the Photosystem I complex. Research has identified several key modifications:

Phosphorylation:

  • Specific serine and threonine residues can be phosphorylated

  • Phosphorylation states change in response to light conditions

  • Affects interaction with other PSI subunits and light-harvesting complexes

  • Potentially regulates state transitions by modifying protein-protein interaction surfaces

Oxidative Modifications:

  • Cysteine residues are susceptible to oxidation under high light or stress conditions

  • Oxidative modifications can alter protein conformation and stability

  • May serve as sensors for redox state of the chloroplast

  • Can be reversible through thioredoxin-mediated reduction

N-terminal Processing:

  • The transit peptide is cleaved during chloroplast import

  • Additional N-terminal processing may occur after integration into the thylakoid membrane

  • Essential for proper folding and assembly into PSI

Methodological approaches for studying PTMs:

  • Mass spectrometry-based phosphoproteomics

  • Site-directed mutagenesis of modification sites

  • In vitro modification assays with purified kinases/phosphatases

  • Redox proteomics to identify oxidative modifications

These studies have demonstrated that PTMs provide a dynamic regulatory layer that fine-tunes PSAF function in response to environmental conditions and developmental stages, ultimately contributing to photosynthetic efficiency and stress responses .

How can PSAF be used in the development of artificial photosynthetic systems?

Recombinant PSAF has significant potential in developing artificial photosynthetic systems due to its role in mediating efficient light harvesting and electron transfer. Researchers can leverage PSAF in several innovative approaches:

Biohybrid Solar Cells:

  • Incorporation of PSAF into designer protein complexes with optimized light-harvesting properties

  • Integration with synthetic electron acceptors to create novel electron transfer pathways

  • Coupling with semiconductor materials to enhance photocurrent generation

  • Development of ordered arrays on electrodes for improved electron collection efficiency

Reconstituted Membrane Systems:

  • Assembly of minimal PSI complexes containing PSAF and essential cofactors

  • Integration into liposomes or nanodiscs for stability in non-native environments

  • Coupling with artificial reaction centers for enhanced photochemical performance

  • Optimization of protein orientation for maximized energy conversion efficiency

Design Parameters and Considerations:

  • Stability of PSAF outside its native environment

  • Engineering specific binding interfaces for novel interaction partners

  • Optimizing cofactor incorporation and electron transfer pathways

  • Enhancing resistance to photodamage for prolonged functionality

These applications require detailed knowledge of PSAF structure-function relationships and often employ protein engineering approaches to enhance stability and performance in artificial contexts. Success in these applications can lead to solar energy conversion systems with improved efficiency inspired by natural photosynthesis .

What techniques are most effective for studying the dynamics of PSAF within the PSI complex?

Advanced biophysical techniques have provided valuable insights into the dynamics of PSAF within the PSI complex:

Time-Resolved Spectroscopy:

  • Ultrafast transient absorption spectroscopy to track energy transfer processes

  • Time-resolved fluorescence spectroscopy to monitor excitation energy dynamics

  • Electron paramagnetic resonance (EPR) for studying electron transfer kinetics

  • Enables tracking of energy flow through PSAF with femtosecond to nanosecond resolution

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Maps protein dynamics and conformational changes

  • Identifies regions of PSAF with different solvent accessibility

  • Particularly useful for studying state transition-related conformational changes

  • Provides peptide-level resolution of dynamic regions

Single-Molecule Techniques:

  • Single-molecule FRET to observe conformational dynamics in real-time

  • Atomic force microscopy (AFM) to visualize structural changes

  • Provides insights into heterogeneity not observable in ensemble measurements

  • Reveals rare or transient conformational states

Molecular Dynamics Simulations:

  • Atomistic simulations of PSAF within the complete PSI complex

  • Prediction of dynamic behaviors and conformational changes

  • Identification of water and lipid interactions that influence dynamics

  • Computational validation of experimentally observed phenomena

These complementary approaches have revealed that PSAF exhibits significant conformational flexibility, particularly during state transitions, and that its dynamics are essential for optimizing photosynthetic efficiency under varying light conditions .

How do environmental factors affect PSAF expression and function in Arabidopsis?

Environmental factors significantly influence both the expression and function of PSAF in Arabidopsis thaliana, reflecting the plant's adaptation to changing conditions:

Light Intensity and Quality:

  • High light intensities typically increase PSAF expression but can lead to photodamage

  • Far-red enriched light enhances PSI-related gene expression, including PSAF

  • Blue light signaling pathways specifically upregulate PSAF transcription

  • Light quality affects the stoichiometry of PSI components, including PSAF

Temperature Effects:

  • Cold stress (4°C) induces changes in PSAF expression and membrane lipid composition

  • Heat stress reduces PSAF stability and affects PSI assembly

  • Temperature shifts alter the dynamics of PSAF interactions within the PSI complex

  • Adaptive responses include changes in PSAF post-translational modifications

Nutrient Availability:

  • Iron deficiency significantly impacts PSAF levels due to its role in iron-sulfur cluster formation

  • Nitrogen limitation alters photosystem stoichiometry, affecting PSAF expression

  • Phosphorus availability influences thylakoid membrane composition and PSAF stability

Research Methodologies:

  • Quantitative PCR for transcript analysis under varying conditions

  • Proteomics approaches to monitor protein abundance changes

  • Chlorophyll fluorescence measurements to assess functional impacts

  • Electron microscopy to evaluate structural changes in PSI organization

These environmental responses highlight the plastic nature of photosynthetic apparatus composition and emphasize PSAF's role in maintaining photosynthetic efficiency across diverse environmental conditions .

What are the current limitations in PSAF research and potential solutions?

Despite significant advances, several important limitations remain in PSAF research that require innovative approaches:

Structural Resolution Challenges:

  • Limited high-resolution structures of plant-specific PSAF conformational states

  • Difficulty in capturing dynamic interactions during state transitions

  • Solution: Apply advanced cryo-EM techniques with improved detectors and processing algorithms to capture transient states

Functional Characterization Gaps:

  • Incomplete understanding of how specific PSAF residues contribute to function

  • Limited knowledge of species-specific variations in PSAF functionality

  • Solution: Systematic mutagenesis combined with in vivo and in vitro functional assays

Expression and Purification Barriers:

  • Challenges in obtaining sufficient quantities of properly folded recombinant PSAF

  • Difficulty maintaining native-like properties in reconstitution experiments

  • Solution: Develop improved expression systems and membrane protein handling techniques

Integration of Data Across Scales:

  • Disconnect between molecular-level insights and whole-plant physiological responses

  • Challenge in translating structural information to ecological adaptation

  • Solution: Multi-scale approaches combining structural biology, biochemistry, and plant physiology

Addressing these limitations will require interdisciplinary collaboration and technological innovation, potentially leading to breakthroughs in understanding the full complexity of PSAF function within photosynthetic systems .

What emerging technologies hold promise for advancing PSAF research?

Several cutting-edge technologies are poised to significantly advance our understanding of PSAF structure, function, and dynamics:

Cryo-Electron Tomography:

  • Enables visualization of PSI complexes in their native membrane environment

  • Provides insights into the spatial organization and interactions of PSAF in intact thylakoids

  • Captures structural heterogeneity not observable in purified samples

Integrative Structural Biology:

  • Combines multiple structural methods (cryo-EM, X-ray crystallography, NMR, SAXS)

  • Generates comprehensive structural models across different spatial and temporal scales

  • Particularly valuable for understanding dynamic assemblies involving PSAF

CRISPR-Based Approaches:

  • Precise genome editing for creating subtle mutations in PSAF

  • Development of conditional and tissue-specific PSAF variants

  • Creation of tagged versions for in vivo tracking with minimal perturbation

Advanced Spectroscopic Methods:

  • Two-dimensional electronic spectroscopy for mapping energy transfer pathways

  • Single-molecule spectroscopy for heterogeneity analysis

  • Ultrafast X-ray spectroscopy at XFELs for tracking electron transfer events

Artificial Intelligence and Machine Learning:

  • Prediction of protein-protein interaction interfaces

  • Analysis of complex spectroscopic data sets

  • Identification of patterns in gene expression and protein modification data

  • Enhanced molecular dynamics simulations of PSAF within complete photosystems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.